IL-1 RAcP/IL-1 R3 Antibody - BSA Free

Immunohistochemistry-Paraffin: IL-1 RAcP/IL-1 R3 Antibody [NBP1-86793] - Staining of human lymph node shows strong cytoplasmic positivity in subsets of cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IL-1 RAcP/IL-1 R3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CRCCVTYCEGENHLRNKSRAEIHNQPQWETHLCKPVPQESETQWIQNGTRLEPPAPQISALALHHFTDLSNNNDF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IL1RAP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended
• Control Peptide:

  IL-1 RAcP/IL-1 R3 Protein (NBP1-86793PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IL-1 RAcP/IL-1 R3 Antibody - BSA Free

• C3orf13IL-1RAcPIL1R3Interleukin-1 receptor 3
• FLJ37788
• IL-1 R3
• IL-1 RAcP
• IL-1 receptor accessory protein
• IL-1R3
• IL-1R-3
• IL1RAcP
• IL-1RAcP
• IL1RAP
• interleukin 1 receptor accessory protein
• interleukin-1 receptor accessory protein beta
• interleukin-1 receptor accessory protein

Background

Nuclear factor kappa B (NF-kappaB) is a ubiquitous transcription factor and an essential mediator of gene expression during activation of immune and inflammatory responses. NF-kappaB mediates the expression of a great variety of genes in response to extracellular stimuli including IL-1, TNFalpha and LPS. A serine/threonine protein kinase associated with IL-1 receptor (IRAK) and its homologue mouse pelle-like protein kinase (mPLK) were identified recently (1,2). IRAK is associated with the IL-1 receptor subunits IL-1RI and IL-1RAcP after IL-1 binding and serves as a signaling molecule to mediate IL-1 response (3). IRAK mediates a signaling cascade leading to NF-kappaB activation by members in IL-1 family including IL-1 and a novel cytokine IL-18 (also termed IGIF) (1,4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IL1RAP