IGSF6/DORA Antibody

Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus tubules.

Analysis in control (vector only transfected HEK293T lysate) and IGSF6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

IGSF6/DORA Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KSNPLRNKEIKEDSQKKKSARRIFQEIAQELYHKRHVETNQQSEKDNNTYENRRVLSNYERP
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IGSF6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for IGSF6/DORA Antibody

• DORA
• DORAdown-regulated by activation (immunoglobulin superfamily)
• IGSF6
• immunoglobulin superfamily member 6
• immunoglobulin superfamily, member 6
• Protein DORA

Background

DORA stands for down-regulated by activation.The Immunoglobulin Superfamily (IgSF) is a group of proteins that are involved in the recognition, binding, or adhesion processes of cells. IgSF proteins got their name because they possess an immunoglobulin (Ig) domain. DORA is also known as protein Immunoglobulin superfamily member 6. Immunoglobulin Superfamily Member 6, IGSF6, has been localized to a locus linked with inflammatory bowel disease; however, studies have shown that it lacks an association to the condition.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IGSF6