| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB |
| Clone | 2A0B5 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Description | Novus Biologicals Rabbit IGFBP-1 Antibody (2A0B5) (NBP3-15425) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 160-259 of human IGFBP-1 (P08833). GSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN |
| Source | HEK293 |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | IGFBP1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for IGFBP-1 Antibody (NBP3-15425)Find related products by research area.
|
|
Detecting HIF alpha and beyond: Best controls for hypoxia Western blot analysis By Rosa Moreno, PhD. Detecting HIF alpha and beyond: Best controls for hypoxia Western blot analysisPhysiological low levels of oxygen induce normal hypoxic events across biological systems. This hypoxic state activ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | IGFBP1 |