IGFBP-1 Antibody (2A0B5) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 160-259 of human IGFBP-1 (P08833). GSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
IGFBP1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for IGFBP-1 Antibody (2A0B5)
Background
IGFBP1 is a gene that codes for an IGF-binding protein that circulates in the plasma and prolongs the half-life of IGFs and works to either inhibit of stimulate the growth promoting effects while also promoting cell migration and has a length of 259 amino acids and a weight of approximately 28 kDa. Current studies are being done on several diseases and disorders relating to this gene including protein-energy malnutrition, pre-eclampsia, persistent fetal circulation syndrome, Silver-Russell syndrome, growth hormone deficiency, Ehlers-Danlos syndrome, glucose intolerance, Prader-Willi syndrome, and chronic fatigue syndrome. IGFBP1 has also been shown to have interactions with IGF1, IGF2, MMP26, TF, and ARNT in pathways such as the myometrial relaxation and contraction, HIF-1-alpha transcription factor, IGF regulation, and protein metabolism pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: Neut, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, Neut, WB
Publications for IGFBP-1 Antibody (NBP3-15425) (0)
There are no publications for IGFBP-1 Antibody (NBP3-15425).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IGFBP-1 Antibody (NBP3-15425) (0)
There are no reviews for IGFBP-1 Antibody (NBP3-15425).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IGFBP-1 Antibody (NBP3-15425) (0)