SPPL3 Antibody

Images

 
Immunohistochemistry-Paraffin: SPPL3 Antibody [NBP2-32505] - Staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPPL3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VLRYDNYKKQASGDSCGAPGPANISGRMQKVSY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPPL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SPPL3 Protein (NBP2-32505PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPPL3 Antibody

  • DKFZp586C1324
  • EC 3.4.23.-
  • IMP-2
  • IMP2MGC126674
  • Intramembrane protease 2
  • MDHV1887
  • MGC126676
  • MGC90402
  • Presenilin-like protein 4
  • PRO4332
  • PSL4
  • signal peptide peptidase 3
  • signal peptide peptidase-like 3
  • SPP-like 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32276
Species: Hu
Applications: WB, IP
NBP2-38956
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBL1-11978
Species: Hu
NBP1-87512
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-55073
Species: Hu
Applications: WB, ICC/IF
NBP1-84339
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59475
Species: Hu
Applications: WB, ELISA, ICC/IF
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF3184
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP1-81002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24611
Species: Hu, Mu, Rt, Bv, Ca, Eq, Op
Applications: WB
NBP2-13958
Species: Hu
Applications: IHC, IHC-P
NB100-74360
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO

Publications for SPPL3 Antibody (NBP2-32505) (0)

There are no publications for SPPL3 Antibody (NBP2-32505).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPPL3 Antibody (NBP2-32505) (0)

There are no reviews for SPPL3 Antibody (NBP2-32505). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SPPL3 Antibody (NBP2-32505) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPPL3 Products

Bioinformatics Tool for SPPL3 Antibody (NBP2-32505)

Discover related pathways, diseases and genes to SPPL3 Antibody (NBP2-32505). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPPL3 Antibody (NBP2-32505)

Discover more about diseases related to SPPL3 Antibody (NBP2-32505).
 

Pathways for SPPL3 Antibody (NBP2-32505)

View related products by pathway.

PTMs for SPPL3 Antibody (NBP2-32505)

Learn more about PTMs related to SPPL3 Antibody (NBP2-32505).

Blogs on SPPL3

There are no specific blogs for SPPL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPPL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPPL3