SPPL3 Antibody - BSA Free

Immunohistochemistry-Paraffin: SPPL3 Antibody [NBP2-32505] - Staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SPPL3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SPPL3 Antibody - BSA Free (NBP2-32505) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VLRYDNYKKQASGDSCGAPGPANISGRMQKVSY
• Predicted Species: Mouse (100%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPPL3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SPPL3 Protein (NBP2-32505PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SPPL3 Antibody - BSA Free

• DKFZp586C1324
• EC 3.4.23.-
• IMP-2
• IMP2MGC126674
• Intramembrane protease 2
• MDHV1887
• MGC126676
• MGC90402
• Presenilin-like protein 4
• PRO4332
• PSL4
• signal peptide peptidase 3
• signal peptide peptidase-like 3
• SPP-like 3

Background

SPPL3 may act as intramembrane protease

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPPL3