IFT122 Antibody - BSA Free

Western Blot: IFT122 Antibody [NBP1-54842] - IFT122 Antibody Titration: 0.2-1 ug/ml Positive Control: 721_B cell lysate

Western Blot: IFT122 Antibody [NBP1-54842] - 1. Human 293FT cell line (15ug) 2. Murine IMCD3 cell line (15ug) 3. Human RPE cell line (15ug) 4. Bovine retina lysate cleared at 100,000Xg for 2 hours (15ug) 5. Mouse Brain lysate (15ug) Primary Dilution: 1 : 1000 Secondary Anditbody: goat anti-rabbit HRPScondary Dilution: 1 : 10,000.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

IFT122 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to IFT122(intraflagellar transport 122 homolog (Chlamydomonas)) The peptide sequence was selected from the C terminal of IFT122. Peptide sequence QADPAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNIS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IFT122
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 129 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for IFT122 Antibody - BSA Free

• intraflagellar transport 122 homolog (Chlamydomonas)
• intraflagellar transport protein 122 homolog
• SPGWD repeat-containing protein 140
• WD repeat domain 10
• WD repeat-containing protein 10
• WDR10WDR10p
• WDR140CED

Background

IFT122 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. IFT122 contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This cytoplasmic protein contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IFT122
• Uniprot:
  • Q9HBG6(Human)