Spastin Antibody (2F5)

Images

 
Western Blot: Spastin Antibody (2F5) [H00006683-M02] - SPAST monoclonal antibody (M02), clone 2F5. Analysis of SPAST expression in Jurkat.
Immunocytochemistry/ Immunofluorescence: Spastin Antibody (2F5) [H00006683-M02] - Analysis of monoclonal antibody to SPAST on HeLa cell . Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Spastin Antibody (2F5) [H00006683-M02] - Analysis of monoclonal antibody to SPAST on formalin-fixed paraffin-embedded human colon. Antibody concentration 1 ~ 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
2F5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Spastin Antibody (2F5) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
SPAST (NP_055761, 200 a.a. ~ 304 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PVLPFSKSQTDVYNDSTNLACRNGHLQSESGAVPKRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQGSGPAPTTHKGTPKTNRTNKPSTP
Specificity
SPAST - spastin (2F5)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SPAST
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publication using H00006683-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Spastin Antibody (2F5)

  • ADPSPSpastic paraplegia 4 protein
  • FSP2EC 3.6.4.3
  • KIAA1083EC 3.6.1.3
  • spastic paraplegia 4 (autosomal dominant; spastin)
  • spastin
  • SPG4

Background

This gene encodes a member of the AAA (ATPases associated with a variety of cellular activities) protein family. Members of this protein family share an ATPase domain and have roles in diverse cellular processes including membrane trafficking, intracellular motility, organelle biogenesis, protein folding, and proteolysis. The encoded ATPase may be involved in the assembly or function of nuclear protein complexes. Two transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants have been described but their full length sequences have not been determined. Mutations associated with this gene cause the most frequent form of autosomal dominant spastic paraplegia 4. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Spastin Antibody (H00006683-M02)(1)

We have publications tested in 3 applications: ICC/IF, IP, WB.


Filter By Application
ICC/IF
(1)
IP
(1)
WB
(1)
All Applications
Filter By Species
All Species

Reviews for Spastin Antibody (H00006683-M02) (0)

There are no reviews for Spastin Antibody (H00006683-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Spastin Antibody (H00006683-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Spastin Products

Array H00006683-M02

Research Areas for Spastin Antibody (H00006683-M02)

Find related products by research area.

Blogs on Spastin

There are no specific blogs for Spastin, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Spastin Antibody (2F5) and receive a gift card or discount.

Bioinformatics

Gene Symbol SPAST
Entrez
Uniprot