IDI1 Antibody

Images

 
Western Blot: IDI1 Antibody [NBP1-85862] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: IDI1 Antibody [NBP1-85862] - Staining of human prostate shows distinct cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IDI1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ADCAQSGRHPGPAVVCGRRLISVLEQIRHFVMMPEINTNHLDKQQVQLLAEMCILIDENDNKIGAETKKN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IDI1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IDI1 Protein (NBP1-85862PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IDI1 Antibody

  • EC 5.3.3.2
  • IPP isomerase 1
  • IPP1
  • IPPI1
  • isopentenyl diphosphate dimethylallyl diphosphate isomerase 1
  • Isopentenyl pyrophosphate isomerase 1
  • isopentenyl-diphosphate delta isomerase 1
  • isopentenyl-diphosphate delta isomerase
  • isopentenyl-diphosphate Delta-isomerase 1

Background

IDI1 encodes a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP), which are the substrates for the successive reaction that results in the synthesis of farnesyl diphosphate and, ultimately, cholesterol. It has been shown in peroxisomal deficiency diseases such as Zellweger syndrome and neonatal adrenoleukodystrophy that there is reduction in IPP isomerase activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IDI1 Antibody (NBP1-85862) (0)

There are no publications for IDI1 Antibody (NBP1-85862).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IDI1 Antibody (NBP1-85862) (0)

There are no reviews for IDI1 Antibody (NBP1-85862). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IDI1 Antibody (NBP1-85862) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IDI1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IDI1