NSDHL Antibody - BSA Free

Immunohistochemistry-Paraffin: NSDHL Antibody [NBP1-83306] - Staining in human epididymis and lymph node tissues using anti-NSDHL antibody. Corresponding NSDHL RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: NSDHL Antibody [NBP1-83306] - Staining of human cerebral cortex, epididymis, lymph node and testis using Anti-NSDHL antibody NBP1-83306 (A) shows similar protein distribution across tissues to independent antibody NBP1-83307 (B).

Western Blot: NSDHL Antibody [NBP1-83306] - Analysis using Anti-NSDHL antibody NBP1-83306 (A) shows similar pattern to independent antibody NBP1-83307 (B).

Immunocytochemistry/Immunofluorescence: NSDHL Antibody [NBP1-83306] - Staining of human cell line A-431 shows localization to endoplasmic reticulum & lipid droplets. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NSDHL Antibody [NBP1-83306] - Staining of human testis using Anti-NSDHL antibody.

Immunohistochemistry-Paraffin: NSDHL Antibody [NBP1-83306] - Staining of human epididymis shows high expression.

Immunohistochemistry-Paraffin: NSDHL Antibody [NBP1-83306] - Staining of human lymph node shows low expression as expected.

Immunohistochemistry-Paraffin: NSDHL Antibody [NBP1-83306] - Staining of human cerebral cortex using Anti-NSDHL antibody.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells))Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells))Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla)

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NSDHL Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LPYAMKPIDYYTETKILQERAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGNGKNLVDFTFVENVVHGHILAAEQLSRDSTLGGKAFHITNDEPIPFWTFLSRI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NSDHL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NSDHL Protein (NBP1-83306PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NSDHL Antibody - BSA Free

• EC 1.1.1.170
• H105e3
• member 1
• NAD(P) dependent steroid dehydrogenase-like
• SDR31E1
• sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating
• XAP104

Background

NSDHL is encoded by this gene is localized in the endoplasmic reticulum and is involved in cholesterol biosynthesis. Mutations in this gene are associated with CHILD syndrome, which is a X-linked dominant disorder of lipid metabolism with disturbed cholesterol biosynthesis, and typically lethal in males. Alternatively spliced transcript variants with differing 5' UTR have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NSDHL Antibody (NBP1-83306)(2)

Publications using NBP1-83306

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]
• Li M, Aliotta JM, Asara JM et al. Intercellular transfer of proteins as identified by stable isotope labeling of amino acids in cell culture. J Biol Chem 2010-02-01 [PMID: 20026604]

Bioinformatics

• Gene Symbol: NSDHL