NSDHL Antibody

Images

 
Western Blot: NSDHL Antibody [NBP1-83306] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human cell line A-431 Lane 5: Human liver tissue
Immunocytochemistry/ Immunofluorescence: NSDHL Antibody [NBP1-83306] - Staining of human cell line A-431 shows localization to endoplasmic reticulum & lipid droplets.
Immunohistochemistry-Paraffin: NSDHL Antibody [NBP1-83306] - Staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.
Western Blot: NSDHL Antibody [NBP1-83306] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NSDHL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LPYAMKPIDYYTETKILQERAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGNGKNLVDFTFVENVVHGHILAAEQLSRDSTLGGKAFHITNDEPIPFWTFLSRI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NSDHL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NSDHL Protein (NBP1-83306PEP)
Publications
Read Publications using NBP1-83306.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NSDHL Antibody

  • EC 1.1.1.170
  • H105e3
  • member 1
  • NAD(P) dependent steroid dehydrogenase-like
  • SDR31E1
  • sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating
  • XAP104

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85699
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58362
Species: Hu
Applications: ICC/IF
NBP1-92450
Species: Hu
Applications: IHC, IHC-P
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-01170
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16463
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33050
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF8516
Species: Hu
Applications: WB, Simple Western, IP, ICC
H00001717-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-85862
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
1705-HH/CF
Species: Hu, Mu
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP

Publications for NSDHL Antibody (NBP1-83306)(2)

Reviews for NSDHL Antibody (NBP1-83306) (0)

There are no reviews for NSDHL Antibody (NBP1-83306). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NSDHL Antibody (NBP1-83306) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NSDHL Products

Bioinformatics Tool for NSDHL Antibody (NBP1-83306)

Discover related pathways, diseases and genes to NSDHL Antibody (NBP1-83306). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NSDHL Antibody (NBP1-83306)

Discover more about diseases related to NSDHL Antibody (NBP1-83306).
 

Pathways for NSDHL Antibody (NBP1-83306)

View related products by pathway.

PTMs for NSDHL Antibody (NBP1-83306)

Learn more about PTMs related to NSDHL Antibody (NBP1-83306).

Blogs on NSDHL

There are no specific blogs for NSDHL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NSDHL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NSDHL