HYPE Antibody - BSA Free

Immunohistochemistry-Paraffin: HYPE Antibody [NBP1-89697] - Staining of human Small intestine shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: HYPE Antibody [NBP1-89697] - Staining of human Cerebellum shows strong granular cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: HYPE Antibody [NBP1-89697] - Staining of human Lung shows strong granular cytoplasmic positivity in pneumocytes and macrophages.

Immunohistochemistry-Paraffin: HYPE Antibody [NBP1-89697] - Staining of human Testis shows strong granular cytoplasmic positivity in Leydig cells and cells in seminiferous ducts.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HYPE Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HYPE Antibody - BSA Free (NBP1-89697) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CLAVLKGLYLLRSKPDRAQHAATKCTSPSTELSITSRGATLLVAKTKASPAGKLEARAALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIID
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FICD
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 1:100-1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HYPE Protein (NBP1-89697PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HYPE Antibody - BSA Free

• AMPylator FICD
• EC 2.7.7.n1
• FIC domain containing
• FIC domain-containing protein
• fic S-phase protein cell division homolog
• HIP-13
• HIP13UNQ3041
• huntingtin interacting protein 13
• Huntingtin interacting protein E
• huntingtin interactor protein E
• Huntingtin yeast partner E
• Huntingtin-interacting protein 13
• Huntingtin-interacting protein E
• HYPEadenosine monophosphate-protein transferase FICD
• MGC5623

Background

Adenylyltransferase that mediates the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins. Able to inactivate Rho GTPases in vitro by adding AMP to RhoA, Rac and Cdc42. It is however unclear whether it inactivates GTPases in vivo and physiological substrates probably remain to be identified

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FICD