HYPE Antibody

Images

 
Western Blot: HYPE Antibody [NBP1-89697] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry-Paraffin: HYPE Antibody [NBP1-89697] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HYPE Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CLAVLKGLYLLRSKPDRAQHAATKCTSPSTELSITSRGATLLVAKTKASPAGKLEARAALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIID
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FICD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HYPE Protein (NBP1-89697PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HYPE Antibody

  • AMPylator FICD
  • EC 2.7.7.n1
  • FIC domain containing
  • FIC domain-containing protein
  • fic S-phase protein cell division homolog
  • HIP-13
  • HIP13UNQ3041
  • huntingtin interacting protein 13
  • Huntingtin interacting protein E
  • huntingtin interactor protein E
  • Huntingtin yeast partner E
  • Huntingtin-interacting protein 13
  • Huntingtin-interacting protein E
  • HYPEadenosine monophosphate-protein transferase FICD
  • MGC5623

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

2629-FG/CF
Species: Mu
NBP1-83254
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45719
Species: Hu
Applications: WB, IHC
NBP1-89843
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87933
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-45897
Species: Hu
Applications: WB, IHC
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-92573
Species: Hu
Applications: WB, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-89697
Species: Hu
Applications: WB, IHC, IHC-P

Publications for HYPE Antibody (NBP1-89697) (0)

There are no publications for HYPE Antibody (NBP1-89697).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HYPE Antibody (NBP1-89697) (0)

There are no reviews for HYPE Antibody (NBP1-89697). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HYPE Antibody (NBP1-89697) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HYPE Products

Bioinformatics Tool for HYPE Antibody (NBP1-89697)

Discover related pathways, diseases and genes to HYPE Antibody (NBP1-89697). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HYPE Antibody (NBP1-89697)

Discover more about diseases related to HYPE Antibody (NBP1-89697).
 

Pathways for HYPE Antibody (NBP1-89697)

View related products by pathway.

Research Areas for HYPE Antibody (NBP1-89697)

Find related products by research area.

Blogs on HYPE

There are no specific blogs for HYPE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HYPE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FICD