FNBP3 Antibody


Western Blot: FNBP3 Antibody [NBP1-87933] - Analysis in human cell line CACO-2.
Immunocytochemistry/ Immunofluorescence: FNBP3 Antibody [NBP1-87933] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: FNBP3 Antibody [NBP1-87933] - Staining of human rectum shows strong nuclear positivity in glandular cells.
Simple Western: FNBP3 Antibody [NBP1-87933] - Simple Western lane view shows a specific band for FNBP3 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions ...read more
Simple Western: FNBP3 Antibody [NBP1-87933] - Electropherogram image(s) of corresponding Simple Western lane view. FNBP3 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).

Product Details

Reactivity HuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P

Order Details

FNBP3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: NASTSASNTVSGTVPVVPEPEVTSIVATVVDNENTVTISTEEQAQLTSTPAIQDQSVEVSSNTGEETSKQETVADFTP
Specificity of human FNBP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Simple Western 1:20
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
FNBP3 Protein (NBP1-87933PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FNBP3 Antibody

  • Fas ligand-associated factor 1
  • Fas-ligand associated factor 1
  • FBP-11
  • FBP11Formin-binding protein 11
  • FLAF1Renal carcinoma antigen NY-REN-6
  • FLJ20585
  • FNBP3Huntingtin-interacting protein A
  • formin binding protein 3
  • Formin-binding protein 3Huntingtin-interacting protein 10
  • HIP10HIP-10
  • HYPAHuntingtin yeast partner A
  • NY-REN-6 antigen
  • NY-REN-6
  • pre-mRNA-processing factor 40 homolog A
  • PRP40 pre-mRNA processing factor 40 homolog A (S. cerevisiae)
  • PRP40 pre-mRNA processing factor 40 homolog A (yeast)
  • Prp40


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt, Bv, Ca, Eq
Applications: WB
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Mu
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for FNBP3 Antibody (NBP1-87933) (0)

There are no publications for FNBP3 Antibody (NBP1-87933).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FNBP3 Antibody (NBP1-87933) (0)

There are no reviews for FNBP3 Antibody (NBP1-87933). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FNBP3 Antibody (NBP1-87933) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FNBP3 Products

Bioinformatics Tool for FNBP3 Antibody (NBP1-87933)

Discover related pathways, diseases and genes to FNBP3 Antibody (NBP1-87933). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FNBP3 Antibody (NBP1-87933)

Discover more about diseases related to FNBP3 Antibody (NBP1-87933).

Pathways for FNBP3 Antibody (NBP1-87933)

View related products by pathway.

PTMs for FNBP3 Antibody (NBP1-87933)

Learn more about PTMs related to FNBP3 Antibody (NBP1-87933).

Blogs on FNBP3

There are no specific blogs for FNBP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FNBP3 Antibody and receive a gift card or discount.


Gene Symbol PRPF40A