FNBP3 Antibody - BSA Free

Western Blot: FNBP3 Antibody [NBP1-87933] - Analysis using Anti-PRPF40A antibody NBP1-87933 (A) shows similar pattern to independent antibody NBP2-38400 (B).

Immunocytochemistry/Immunofluorescence: FNBP3 Antibody [NBP1-87933] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.

Immunohistochemistry-Paraffin: FNBP3 Antibody [NBP1-87933] - Staining of human rectum shows strong nuclear positivity in glandular cells.

Simple Western: FNBP3 Antibody [NBP1-87933] - Electropherogram image(s) of corresponding Simple Western lane view. FNBP3 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).

Analysis in human cell line CACO-2.

• Reactivity: Hu
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FNBP3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FNBP3 Antibody - BSA Free (NBP1-87933) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-FNBP3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NASTSASNTVSGTVPVVPEPEVTSIVATVVDNENTVTISTEEQAQLTSTPAIQDQSVEVSSNTGEETSKQETVADFTP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRPF40A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 160 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  FNBP3 Protein (NBP1-87933PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FNBP3 Antibody - BSA Free

• Fas ligand-associated factor 1
• Fas-ligand associated factor 1
• FBP-11
• FBP11Formin-binding protein 11
• FLAF1Renal carcinoma antigen NY-REN-6
• FLJ20585
• FNBP3Huntingtin-interacting protein A
• formin binding protein 3
• Formin-binding protein 3Huntingtin-interacting protein 10
• HIP10HIP-10
• HYPAHuntingtin yeast partner A
• NY-REN-6 antigen
• NY-REN-6
• pre-mRNA-processing factor 40 homolog A
• PRP40 pre-mRNA processing factor 40 homolog A (S. cerevisiae)
• PRP40 pre-mRNA processing factor 40 homolog A (yeast)
• Prp40

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FNBP3 Antibody (NBP1-87933)(1)

Publication using NBP1-87933

• Pawellek A, Ryder U, Tammsalu T, King LJ et Al. Characterisation of the biflavonoid hinokiflavone as a pre-mRNA splicing modulator that inhibits SENP Elife 2017-09-09 [PMID: 28884683]

Bioinformatics

• Gene Symbol: PRPF40A
• Entrez:
  • 55660(Human)
• Uniprot:
  • O75400(Human)