PSMD8 Antibody

Images

 
Western Blot: PSMD8 Antibody [NBP1-83254] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: PSMD8 Antibody [NBP1-83254] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: PSMD8 Antibody [NBP1-83254] - Staining of human cerebral cortex shows moderate cytoplasmic and weak nuclear positivity in neuronal cells.
Western Blot: PSMD8 Antibody [NBP1-83254] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PSMD8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMD8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PSMD8 Protein (NBP1-83254PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PSMD8 Antibody

  • 26S proteasome non-ATPase regulatory subunit 8
  • 26S proteasome regulatory subunit p31
  • HIP6,26S proteasome regulatory subunit S14
  • HYPF
  • MGC1660
  • Nin1p
  • p3126S proteasome regulatory subunit RPN12
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 8
  • Rpn12
  • S14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57365
Species: Hu
Applications: WB
AF6574
Species: Mu
Applications: WB
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00006223-M01
Species: Hu
Applications: WB, ELISA
NBP1-81545
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-13262
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92350
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80961
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006192-P01
Species: Hu
NBP1-82761
Species: Hu
Applications: IHC, IHC-P

Publications for PSMD8 Antibody (NBP1-83254) (0)

There are no publications for PSMD8 Antibody (NBP1-83254).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSMD8 Antibody (NBP1-83254) (0)

There are no reviews for PSMD8 Antibody (NBP1-83254). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PSMD8 Antibody (NBP1-83254) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PSMD8 Products

Bioinformatics Tool for PSMD8 Antibody (NBP1-83254)

Discover related pathways, diseases and genes to PSMD8 Antibody (NBP1-83254). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSMD8 Antibody (NBP1-83254)

Discover more about diseases related to PSMD8 Antibody (NBP1-83254).
 

Pathways for PSMD8 Antibody (NBP1-83254)

View related products by pathway.

PTMs for PSMD8 Antibody (NBP1-83254)

Learn more about PTMs related to PSMD8 Antibody (NBP1-83254).
 

Research Areas for PSMD8 Antibody (NBP1-83254)

Find related products by research area.

Blogs on PSMD8

There are no specific blogs for PSMD8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSMD8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMD8