PSMD8 Antibody

Images

 
Western Blot: PSMD8 Antibody [NBP1-83254] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: PSMD8 Antibody [NBP1-83254] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: PSMD8 Antibody [NBP1-83254] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: PSMD8 Antibody [NBP1-83254] - Staining of human cerebellum shows moderate nuclear positivity in Purkinje cells.
Immunohistochemistry-Paraffin: PSMD8 Antibody [NBP1-83254] - Staining of human pancreas shows very weak positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: PSMD8 Antibody [NBP1-83254] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PSMD8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMD8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 1:100-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PSMD8 Protein (NBP1-83254PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PSMD8 Antibody

  • 26S proteasome non-ATPase regulatory subunit 8
  • 26S proteasome regulatory subunit p31
  • HIP6,26S proteasome regulatory subunit S14
  • HYPF
  • MGC1660
  • Nin1p
  • p3126S proteasome regulatory subunit RPN12
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 8
  • Rpn12
  • S14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84847
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-73636
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
NBP1-87797
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP2-67301
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00006201-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP2-94502
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-75649
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-81545
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
NB100-2682
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-22289
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-80959
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-93953
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38780
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80961
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00006192-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-94118
Species: Hu, Mu, Rt
Applications: WB

Publications for PSMD8 Antibody (NBP1-83254) (0)

There are no publications for PSMD8 Antibody (NBP1-83254).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSMD8 Antibody (NBP1-83254) (0)

There are no reviews for PSMD8 Antibody (NBP1-83254). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PSMD8 Antibody (NBP1-83254) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PSMD8 Products

Bioinformatics Tool for PSMD8 Antibody (NBP1-83254)

Discover related pathways, diseases and genes to PSMD8 Antibody (NBP1-83254). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSMD8 Antibody (NBP1-83254)

Discover more about diseases related to PSMD8 Antibody (NBP1-83254).
 

Pathways for PSMD8 Antibody (NBP1-83254)

View related products by pathway.

PTMs for PSMD8 Antibody (NBP1-83254)

Learn more about PTMs related to PSMD8 Antibody (NBP1-83254).
 

Research Areas for PSMD8 Antibody (NBP1-83254)

Find related products by research area.

Blogs on PSMD8

There are no specific blogs for PSMD8, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSMD8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMD8