Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.
Reactivity | HuSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | FLJ13154 (AAH04415, 1 a.a. - 265 a.a.) full-length human protein. MSAAPLVGYSSSGSEDESEDGMRTRPGDGSHRRGQSPLPRQRFPVPDSVLNMFPGTEEGPEDDSTKHGGRVRTFPHERGNWATHVYVPYEAKEEFLDLLDVLLPHAQTYVPRLVRMKVFHLSLSQSVVLRHHWILPFVQALKARMTSFHRFFFTANQVKIYTNQEKTRTFIGLEVTSGHAQFLDLVSEVDRVMEEFNLTTFYQDPSFHLSLAWCVGDARLQLEGQCLQELQAIVDGSEDAEVLLRVHTEQVRCKSGNKFFSMPLK |
Specificity | FLJ13154 - hypothetical protein FLJ13154, |
Isotype | IgG |
Clonality | Polyclonal |
Host | Mouse |
Gene | USB1 |
Purity | IgG purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.4) |
Preservative | No Preservative |
Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Diseases for HVSL1 Antibody (H00079650-B01P)Discover more about diseases related to HVSL1 Antibody (H00079650-B01P).
| Pathways for HVSL1 Antibody (H00079650-B01P)View related products by pathway.
|
Research Areas for HVSL1 Antibody (H00079650-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.