New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Home » HVSL1 » HVSL1 Antibodies » HVSL1 Antibody

HVSL1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: HVSL1 Antibody [H00079650-B01P] - Analysis of C16orf57 expression in transfected 293T cell line by C16orf57 polyclonal antibody. Lane 1: FLJ13154 transfected lysate(29.26 KDa). Lane 2: Non-transfected lysate.
Western Blot: HVSL1 Antibody [H00079650-B01P] - Analysis of C16orf57 expression in transfected 293T cell line by C16orf57 polyclonal antibody. Lane 1: FLJ13154 transfected lysate(29.26 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

HVSL1 Antibody Summary

Immunogen
FLJ13154 (AAH04415, 1 a.a. - 265 a.a.) full-length human protein. MSAAPLVGYSSSGSEDESEDGMRTRPGDGSHRRGQSPLPRQRFPVPDSVLNMFPGTEEGPEDDSTKHGGRVRTFPHERGNWATHVYVPYEAKEEFLDLLDVLLPHAQTYVPRLVRMKVFHLSLSQSVVLRHHWILPFVQALKARMTSFHRFFFTANQVKIYTNQEKTRTFIGLEVTSGHAQFLDLVSEVDRVMEEFNLTTFYQDPSFHLSLAWCVGDARLQLEGQCLQELQAIVDGSEDAEVLLRVHTEQVRCKSGNKFFSMPLK
Specificity
FLJ13154 - hypothetical protein FLJ13154,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
USB1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HVSL1 Antibody

  • C16orf57
  • chromosome 16 open reading frame 57
  • FLJ13154
  • HVSL motif containing 1
  • HVSL1
  • hypothetical protein LOC79650
  • PN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...


5'-Nucleotidase/CD73 A ...
NBP2-48480
Flow (Cell Surface): 5'-Nucleotidase/CD73 Antibody (AD2) [NBP2-48480] - A surface stain was performed on U87 MG cells with 5'-Nucleotidase/CD73 Antibody (AD2) antibody NBP2-48480 (blue) and a matched isotype control (orange). Cells were incubated in an antibody dilution of 1 ug/mL for 20 minutes at room temperature, followed by Dylight488-conjugated anti-mouse secondary antibody.
Flow (Cell Surface): 5'-Nucleotidase/CD73 Antibody (AD2) [NBP2-48480] - A cell surface stain was performed on U87MG cells with NBP2-48480APC (blue) and a matched isotype control NBP2-27287APC (orange). Cells were incubated in an antibody dilution of 0.5 ug/mL for 20 minutes at room temperature. Both antibodies were conjugated to Allophycocyanin. Image using the Allophycocyanin form of this antibody.
Flow Cytometry: 5'-Nucleotidase/CD73 Antibody (AD2) [NBP2-48480] - A surface stain was performed on CD3+ human peripheral blood lymphocytes with CD73 (AD2) antibody NBP2-48480AF488 and a matched isotype control NBP2-27287AF488. Cells were incubated in an antibody dilution of 10 ug/mL for 20 minutes at room temperature. A co-stain was performed with NBP2-25186PCP.
(1 Review)
(15 Publications)
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin was detected in immersion fixed BG01V human embryonic stem cells differentiated to hepatocytes using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. Cells were co-stained using Sheep Anti-Human CEBP alpha (Catalog # AF7094) and NorthernLights™ 493-conjugated Anti-Sheep IgG Secondary Antibody (green, Catalog # NL012). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Albumin was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 0.1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm and plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(5 Reviews)
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(708 Publications)
Species: Hu
Applications: BA
Catalase Antibody
[Unconjugated]
AF3398
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Raji human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Catalase at approximately 62 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Catalase knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Catalase at approximately 64 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(7 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
PDXP Antibody
NBP2-27461
Immunohistochemistry-Paraffin: PDXP Antibody [NBP2-27461] - 5ug/ml staining of paraffin embedded Human Tonsil. Steamed antigen retrieval with citrate buffer Ph 6, AP-staining.
Western Blot: PDXP Antibody [NBP2-27461] - NBP2-27461 (0.1ug/ml) staining of Human Heart lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Western Blot: PDXP Antibody [NBP2-27461] - 0.1 ug/ml staining of Mouse (A) and Rat (B) Brain lysates (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
GLYAT Antibody
NBP2-58917
Western Blot: GLYAT Antibody [NBP2-58917] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human duodenum shows low expression as expected.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human kidney shows high expression.
Species: Hu
Applications: IHC, IHC-P, WB
Peroxiredoxin 5
Antibody [Unconjugate
AF5724
Western blot shows lysates of human, mouse, and rat brain tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat Peroxiredoxin 5 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5724) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Peroxiredoxin 5 at approximately 17 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Peroxiredoxin 5 was detected in immersion fixed A549 human lung carcinoma cell line using Goat Anti-Human/Mouse/Rat Peroxiredoxin 5 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5724) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to mitochondria. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Peroxiredoxin 5 was detected in immersion fixed A549 human lung carcinoma cell line using Goat Anti-Human/Mouse/Rat Peroxiredoxin 5 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5724) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm (mitochondria). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu, Mu, Rt
Applications: ICC, WB
CRAT Antibody
NBP1-86615
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86615] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86615] - Staining of human tonsil shows low expression as expected.
Western Blot: CRAT Antibody [NBP1-86615] - Staining in human testis and tonsil tissues using anti-CRAT antibody. Corresponding CRAT RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P, WB
Myelin PLP Antibody
NBP1-87781
Immunohistochemistry-Paraffin: Myelin PLP Antibody [NBP1-87781] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Myelin PLP Antibody [NBP1-87781] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Myelin PLP Antibody [NBP1-87781] - Staining in human cerebral cortex and pancreas tissues using anti-PLP1 antibody. Corresponding PLP1 RNA-seq data are presented for the same tissues.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Recombinant Human
PTHLH/PTHrP Protein
NBP2-35224
SDS-Page: Human PTHLH/PTHrP Protein [NBP2-35224]
Species: Hu
Applications: Func, PAGE
BDNF [HRP]
DBD00
(4 Reviews)
(72 Publications)
Species: Hu
Applications: ELISA
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(14 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
PRB1 Antibody
NBP3-10064
Western Blot: PRB1 Antibody [NBP3-10064] - Western blot analysis of PRB1 in Human Hela Whole Cell lysates. Antibody dilution at 1ug/ml
Species: Hu
Applications: WB
Pancreatic
Polypeptide/PP Antibo
NB100-1793
Flow Cytometry: Pancreatic Polypeptide/PP Antibody [NB100-1793] - Flow cytometric analysis of paraformaldehyde fixed U2OS cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Immunohistochemistry-Paraffin: Pancreatic Polypeptide/PP Antibody [NB100-1793] - Staining of paraffin embedded Human Pancreas with antibody at 3 ug/mL. Microwaved antigen retrieval with Tris/EDTA buffer pH 9, HRP-staining.
Immunocytochemistry/Immunofluorescence: Pancreatic Polypeptide/PP Antibody [NB100-1793] - Histologic comparison of wild type and Seriola dumerili mouse pancreata. Seriola dumerili Ins2 mice (bottom) have normal islet morphology and cyto-architecture compared to littermates with endogenous mouse Ins 1 and Ins 2 (top); pancreatic polypeptide (green; B,E). Scale bar: 100 um. Image collected and cropped by CiteAb from the following publication (www.nature.com/articles/s41598-019-40768-3) licensed under a CC-BY licence.
(3 Reviews)
(16 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
IGF-I/IGF-1
[Unconjugated]
291-G1
1 μg/lane of Recombinant Human IGF-I/IGF-1 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 7 kDa.
Recombinant Human IGF-I/IGF-1 (Catalog # 291-G1) stimulates proliferation in the MCF-7 human breast cancer cell line. The ED50 for this effect is 0.3‑1.5 ng/mL.
MALDI-TOF analysis of Recombinant Human IGF-I/IGF-1.The major peak corresponds to the calculated molecular mass, 7650 Da. The minor peak at 7873 is a matrix-associated artifact of the MALDI-TOF.
(8 Reviews)
(173 Publications)
Species: Hu
Applications: BA
IL-6 [HRP]
D6050
(32 Reviews)
(605 Publications)
Species: Hu
Applications: ELISA
CYLD Antibody
NB110-95574
Immunocytochemistry/Immunofluorescence: CYLD Antibody [NB110-95574] - CYLD antibody was tested in A431 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Western Blot: CYLD Antibody [NB110-95574] - Detection of CYLD in Jurkat whole cell extract using NB110-95574.
(1 Publication)
Species: Bv, Hu, Mu, Pm, Rt(-)
Applications: ICC/IF, WB
C-Reactive
Protein/CRP [HRP]
DCRP00
(4 Reviews)
(117 Publications)
Species: Hu
Applications: ELISA
Growth Hormone
Antibody [Unconjugate
AF1067
Western blot shows lysates of human, mouse, and rat pituitary gland tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Growth Hormone at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Human Growth Hormone protein was serially diluted 2-fold and captured by Mouse Anti-Human Growth Hormone Monoclonal Antibody (Catalog # MAB10671) coated on a Clear Polystyrene Microplate (Catalog # DY990). Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
Recombinant Human Growth Hormone (Catalog # 1067-GH) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Growth Hormone (0.2 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067). The ND50 is typically 1.5-7.5 ng/mL.
(3 Reviews)
(9 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Hepsin
4776-SE
Hepsin
(3 Reviews)
(5 Publications)
Species: Hu
Applications: EnzAct

Publications for HVSL1 Antibody (H00079650-B01P) (0)

There are no publications for HVSL1 Antibody (H00079650-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HVSL1 Antibody (H00079650-B01P) (0)

There are no reviews for HVSL1 Antibody (H00079650-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HVSL1 Antibody (H00079650-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HVSL1 Products

Bioinformatics Tool for HVSL1 Antibody (H00079650-B01P)

Discover related pathways, diseases and genes to HVSL1 Antibody (H00079650-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HVSL1 Antibody (H00079650-B01P)

Discover more about diseases related to HVSL1 Antibody (H00079650-B01P).
 

Pathways for HVSL1 Antibody (H00079650-B01P)

View related products by pathway.

Research Areas for HVSL1 Antibody (H00079650-B01P)

Find related products by research area.

Blogs on HVSL1

There are no specific blogs for HVSL1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HVSL1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol USB1
Entrez
Uniprot