HTRA2/Omi Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: HTRA2/Omi Antibody [NBP2-58890] - Staining of human cell line U-2 OS shows localization to mitochondria.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HTRA2/Omi Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HTRA2/Omi Antibody - BSA Free (NBP2-58890) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSP
• Predicted Species: Mouse (92%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HTRA2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HTRA2/Omi Recombinant Protein Antigen (NBP2-58890PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HTRA2/Omi Antibody - BSA Free

• High temperature requirement protein A2
• HtrA serine peptidase 2
• HTRA2
• HtrA-like serine protease
• Omi
• OMIOmi stress-regulated endoprotease
• PARK13EC 3.4.21.108
• PRSS25
• PRSS25serine, 25
• Serine protease 25
• serine protease HTRA2, mitochondrial
• Serine proteinase OMI

Background

HtrA2 (Omi) is a serine protease that plays a significant role in programmed cell death, or apoptosis. Localized to the intermembrane space of the mitochondria, HtrA2 exists predominantly as two isoforms (1). In response to cellular stress signals, HtrA2 is released into the cytosol. One way that HtrA2 induces apoptosis is by binding to BIRC proteins (also called inhibitor of apoptosis proteins, IAPs), and thereby inhibiting their caspase-inhibitory activity (2,3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HTRA2