HSD3B7 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: VVRMLLQREPRLGELRVFDQHLGPWLEELKTGPVRVTAIQGDVTQAHEVAAAVAGAHVVIHTAGLVDVFGRASPKTIHEVNVQG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HSD3B7 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for HSD3B7 Antibody - BSA Free
Background
HSD3B7 codes for a protein with a length of 369 amino acids and a weight of approximately 41 kDa, with a shorter isoform with a length of 196 amino acids and a weight of approximately 21 kDa, and is a protein that plays a role in the biosynthesis of all classes of hormonal steroids, as it does not metabolize several different C steroids as substrates. It is also involved in bile acid synthesis from cholesterol. Current studies are being done on diseases and disorders relating to this gene including congenital bile acid synthesis defect, hepatitis, jaundice, cholesterol, tuberculosis, and neuronitis. HSD3B7 has also been shown to have interactions with PLSCR1, AKR1D1, CYP27A1, CYP39A1, and CYP7A1 in pathways such as the bile acid biosynthesis and metabolic pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Pm, Bv, Gt, Hu, Mu, Po, Pm, Rt, Sh
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Pm, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: DirELISA, IHC, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ICC, IP, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Publications for HSD3B7 Antibody (NBP2-14103) (0)
There are no publications for HSD3B7 Antibody (NBP2-14103).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HSD3B7 Antibody (NBP2-14103) (0)
There are no reviews for HSD3B7 Antibody (NBP2-14103).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HSD3B7 Antibody (NBP2-14103) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HSD3B7 Products
Blogs on HSD3B7