HSD3B1 Antibody - BSA Free

Western Blot: HSD3B1 Antibody [NBP3-10203] - Western blot analysis of HSD3B1 in Mouse Brain lysates. Antibody dilution at 1ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

HSD3B1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HSD3B1 Antibody - BSA Free (NBP3-10203) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse HSD3B1 (NP_001155214.1). Peptide sequence DIVLNGHEDEHRESTWSDPYPYSKKMAEKAVLAANGSMLKNGGTLQTCAL
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HSD3B1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for HSD3B1 Antibody - BSA Free

• 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
• 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I
• 3-beta-HSD I
• 3BETAHSD
• 3-beta-hydroxy-Delta(5)-steroid dehydrogenase
• 3BH
• delta-5-3-ketosteroid isomerase
• EC 1.1.1
• HSD3B
• HSDB3
• HSDB3A
• hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1
• hydroxy-delta-5-steroid dehydrogenase, 3 beta-and steroid delta-isomerase 1
• I
• progesterone reductase
• SDR11E1
• short chain dehydrogenase/reductase family 11E, member 1,3-beta-hydroxy-5-ene steroid dehydrogenase
• steroid Delta-isomerase
• Trophoblast antigen FDO161G

Background

3beta-hydroxysteroid dehydrogenase/delta(5)-delta(4)isomerase (HSD3B1) is a bifunctional enzyme involved in the oxidative conversion of steroids and plays an important role in the synthesis of all steroid hormones. There are two HSD3B1 proteins--designated type I and type II--that are expressed by different genes and function in different areas of the body. HSD3B1 has also been shown to be a highly specific and sensitive trophoblast-associated marker.

HSD3B1 is required for the production of progesterone by the placenta, so it is predicted that mutations in this gene may cause infertility in women. HSD3B1 antibodies are useful tools for researchers studying hormone regulation and reproductive biology.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HSD3B1