HSD17B7 Antibody - Azide and BSA Free

Western Blot: HSD17B7 Antibody [NBP3-15527] - Western blot analysis of extracts of various cell lines, using HSD17B7 Rabbit pAb (NBP3-15527) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5min.

Immunohistochemistry-Paraffin: HSD17B7 Antibody [NBP3-15527] - Immunohistochemistry of paraffin-embedded Human breast cancer using HSD17B7 Rabbit pAb (NBP3-15527) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

HSD17B7 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 110-200 of human HSD17B7 (NP_057455.1). SRKVIHMFSTAEGLLTQGDKITADGLQEVFETNVFGHFILIRELEPLLCHSDNPSQLIWTSSRSARKSNFSLEDFQHSKGKEPYSSSKYAT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HSD17B7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for HSD17B7 Antibody - Azide and BSA Free

• 17 beta-hydroxysteroid dehydrogenase type VII
• 17-beta-hydroxysteroid dehydrogenase 7
• 3-keto-steroid reductase
• EC 1.1.1.270
• EC 1.1.1.62
• Estradiol 17-beta-dehydrogenase 7
• hydroxysteroid (17-beta) dehydrogenase 7,17beta hydroxysteroid dehydrogenase
• MGC12523
• MGC75018,17-beta-HSD 7
• PRAP
• SDR37C1
• short chain dehydrogenase/reductase family 37C, member 1

Background

The 17-beta-hydroxysteroid dehydrogenase enzyme (EC 1.1.1.62) oxidizes or reduces estrogens and androgens in mammals and regulates the biologic potency of these steroids.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: HSD17B7