HSD17B7 Antibody

Images

 
Immunohistochemistry-Paraffin: HSD17B7 Antibody [NBP2-14102] Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HSD17B7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ANAFTLTPYNGTEALVWLFHQKPESLNPLIKYLSATTGFGRNYIMTQKMD LDEDTAEKFYQKLLELEKHIRVTIQKTDNQARLSGSC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSD17B7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HSD17B7 Protein (NBP2-14102PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HSD17B7 Antibody

  • 17 beta-hydroxysteroid dehydrogenase type VII
  • 17-beta-hydroxysteroid dehydrogenase 7
  • 3-keto-steroid reductase
  • EC 1.1.1.270
  • EC 1.1.1.62
  • Estradiol 17-beta-dehydrogenase 7
  • hydroxysteroid (17-beta) dehydrogenase 7,17beta hydroxysteroid dehydrogenase
  • MGC12523
  • MGC75018,17-beta-HSD 7
  • PRAP
  • SDR37C1
  • short chain dehydrogenase/reductase family 37C, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
MAB7178
Species: Hu
Applications: WB, Simple Western
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-92011
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-561
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NB200-305
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
MAB6799
Species: Hu
Applications: WB, IHC
NBP1-31378
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA

Publications for HSD17B7 Antibody (NBP2-14102) (0)

There are no publications for HSD17B7 Antibody (NBP2-14102).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSD17B7 Antibody (NBP2-14102) (0)

There are no reviews for HSD17B7 Antibody (NBP2-14102). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HSD17B7 Antibody (NBP2-14102) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HSD17B7 Products

Bioinformatics Tool for HSD17B7 Antibody (NBP2-14102)

Discover related pathways, diseases and genes to HSD17B7 Antibody (NBP2-14102). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSD17B7 Antibody (NBP2-14102)

Discover more about diseases related to HSD17B7 Antibody (NBP2-14102).
 

Pathways for HSD17B7 Antibody (NBP2-14102)

View related products by pathway.

PTMs for HSD17B7 Antibody (NBP2-14102)

Learn more about PTMs related to HSD17B7 Antibody (NBP2-14102).

Blogs on HSD17B7

There are no specific blogs for HSD17B7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSD17B7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD17B7