HSD17B7 Antibody - BSA Free

Immunohistochemistry-Paraffin: HSD17B7 Antibody [NBP2-14102] - Staining of human lung shows moderate cytoplasmic positivity in pneumocytes and macrophages.

Immunohistochemistry-Paraffin: HSD17B7 Antibody [NBP2-14102] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: HSD17B7 Antibody [NBP2-14102] - Staining of human breast shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: HSD17B7 Antibody [NBP2-14102] - Staining of human liver shows moderate positivity in hepatocytes.

Immunohistochemistry-Paraffin: HSD17B7 Antibody [NBP2-14102] - Staining of human skeletal muscle shows cytoplasmic positivity in myocytes.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HSD17B7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HSD17B7 Antibody - BSA Free (NBP2-14102) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: ANAFTLTPYNGTEALVWLFHQKPESLNPLIKYLSATTGFGRNYIMTQKMDLDEDTAEKFYQKLLELEKHIRVTIQKTDNQARLSGSC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HSD17B7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HSD17B7 Protein (NBP2-14102PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HSD17B7 Antibody - BSA Free

• 17 beta-hydroxysteroid dehydrogenase type VII
• 17-beta-hydroxysteroid dehydrogenase 7
• 3-keto-steroid reductase
• EC 1.1.1.270
• EC 1.1.1.62
• Estradiol 17-beta-dehydrogenase 7
• hydroxysteroid (17-beta) dehydrogenase 7,17beta hydroxysteroid dehydrogenase
• MGC12523
• MGC75018,17-beta-HSD 7
• PRAP
• SDR37C1
• short chain dehydrogenase/reductase family 37C, member 1

Background

The 17-beta-hydroxysteroid dehydrogenase enzyme (EC 1.1.1.62) oxidizes or reduces estrogens and androgens in mammals and regulates the biologic potency of these steroids.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HSD17B7