HRD1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: HRD1 Antibody [NBP1-89667] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & endoplasmic reticulum.

Staining of human cerebral cortex, lymphoid tissues, pancreas and skeletal muscle using Anti-SYVN1 antibody NBP1-89667 (A) shows similar protein distribution across tissues to independent antibody NBP1-89668 (B).

Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HRD1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HRD1 Antibody - BSA Free (NBP1-89667) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-HRD1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PAPGFPFPPPWMGMPLPPPFAFPPMPVPPAGFAGLTPEELRALEGHERQHLEARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVVAAASSTSIPSSEATTPTPGASPPAPEMERPPAPESVGT
• Predicted Species: Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SYVN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HRD1 Protein (NBP1-89667PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HRD1 Antibody - BSA Free

• E3 ubiquitin-protein ligase synoviolin
• EC 6.3.2
• HRD1EC 6.3.2.-
• KIAA1810Synovial apoptosis inhibitor 1
• MGC40372
• synovial apoptosis inhibitor 1, synoviolin

Background

HRD1 is a ubiquitin ligase whose expression is induced by the unfolded protein response (UPR) following endoplasmic reticulum stress. Expression of HRD1 protects cells from apoptosis by inducing degradation of abnormally processed proteins that accumulate in the endoplasmic reticulum. HRD1 is expressed in many tissues, strongly expressed in brain, pancreas, liver, kidney and skeletal muscle. It has been reported that Synoviolin/Hrd1 (expressed in rheumatoid synovium) is a novel causative factor for arthropathy by triggering synovial cell outgrowth through its anti-apoptotic effects. HRD1 contains one ring-type zinc finger.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HRD1 Antibody (NBP1-89667)(1)

Publication using NBP1-89667

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: SYVN1