HRD1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HRD1 Antibody [NBP1-89667] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & endoplasmic reticulum.
Immunohistochemistry-Paraffin: HRD1 Antibody [NBP1-89667] - Staining of human lymph node.
Immunohistochemistry-Paraffin: HRD1 Antibody [NBP1-89667] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells
Immunohistochemistry-Paraffin: HRD1 Antibody [NBP1-89667] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: HRD1 Antibody [NBP1-89667] - Staining of human tonsil shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: HRD1 Antibody [NBP1-89667] - Staining in human tonsil and skeletal muscle tissues using anti-SYVN1 antibody. Corresponding SYVN1 RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: HRD1 Antibody [NBP1-89667] - Staining of human cerebral cortex, lymph node, skeletal muscle and tonsil using Anti-SYVN1 antibody NBP1-89667 (A) shows similar ...read more
Immunohistochemistry-Paraffin: HRD1 Antibody [NBP1-89667] - Staining of human cerebral cortex.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HRD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PAPGFPFPPPWMGMPLPPPFAFPPMPVPPAGFAGLTPEELRALEGHERQHLEARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVVAAASSTSIPSSEATTPTPGASPPAPEMERPPAPESVGT
Specificity
Specificity of human HRD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYVN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HRD1 Protein (NBP1-89667PEP)
Publications
Read Publication using NBP1-89667.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HRD1 Antibody

  • E3 ubiquitin-protein ligase synoviolin
  • EC 6.3.2
  • HRD1EC 6.3.2.-
  • KIAA1810Synovial apoptosis inhibitor 1
  • MGC40372
  • synovial apoptosis inhibitor 1, synoviolin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11433
Species: Hu, Mu, Rt, Pm, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-15374
Species: Hu
Applications: WB, Func, IHC, IHC-P, In vitro
NB100-448
Species: Hu, Mu, Ca, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-93746
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-00990
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40591
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-43760
Species: Hu
Applications: WB, ICC/IF, IHC-Fr, IHC-P
NB120-11929
Species: Hu, Mu
Applications: WB, Flow
NBP1-06274
Species: Hu, Mu, Rt, Ce, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IHC-FrFl
NBP2-45402
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC
NBP1-40256
Species: Hu, Mu, Rt, Po, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC, KO
NBP2-74746
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC
NBP1-06088
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-89667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for HRD1 Antibody (NBP1-89667)(1)

Reviews for HRD1 Antibody (NBP1-89667) (0)

There are no reviews for HRD1 Antibody (NBP1-89667). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HRD1 Antibody (NBP1-89667) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HRD1 Products

Bioinformatics Tool for HRD1 Antibody (NBP1-89667)

Discover related pathways, diseases and genes to HRD1 Antibody (NBP1-89667). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HRD1 Antibody (NBP1-89667)

Discover more about diseases related to HRD1 Antibody (NBP1-89667).
 

Pathways for HRD1 Antibody (NBP1-89667)

View related products by pathway.

PTMs for HRD1 Antibody (NBP1-89667)

Learn more about PTMs related to HRD1 Antibody (NBP1-89667).
 

Research Areas for HRD1 Antibody (NBP1-89667)

Find related products by research area.

Blogs on HRD1.

OS9: Taking proteins to the ER finish line
The OS9 protein is a lectin/glycoprotein that maintains endoplasmic reticulum (ER) quality control and ER-associated degradation (the so-called ERAD pathway) of newly synthesized proteins. It is essential for the recognition of terminally misfolded no...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HRD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYVN1