HOXB13 Antibody

Images

 
Western Blot: HOXB13 Antibody [NBP2-49375] - Staining of human liver shows low expression as expected.
Immunocytochemistry/ Immunofluorescence: HOXB13 Antibody [NBP2-49375] - Staining of human cell line PC-3 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-49375] - Staining of human colon.
Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-49375] - Staining of human prostate shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-49375] - Staining in human prostate and liver tissues using anti-HOXB13 antibody. Corresponding HOXB13 RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-49375] - Staining of human colon, liver, prostate and rectum using Anti-HOXB13 antibody NBP2-49375 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-49375] - Staining of human rectum.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOXB13 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAPLDLPGSAEPPKQCHPCPGVPQGTSPAPVPYGY
Specificity
Specificity of human HOXB13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HOXB13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HOXB13 Antibody

  • homeo box B13
  • homeobox B13
  • homeobox protein Hox-B13
  • HOXB13
  • PSGD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1207
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-56603
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
NB100-1828
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
H00006934-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-53144
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye, Ze
Applications: WB, IHC
NB300-131
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-87508
Species: Hu
Applications: WB, IHC, IHC-P
H00003216-M01-100ug
Species: Hu
Applications: WB, ELISA
NBP2-14098
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
H00003209-Q01
Species: Hu
AF6318
Species: Hu
Applications: ICC
AF5415
Species: Hu
Applications: WB, IHC, ICC
H00051450-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-56557
Species: Hu
Applications: ICC/IF

Publications for HOXB13 Antibody (NBP2-49375) (0)

There are no publications for HOXB13 Antibody (NBP2-49375).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXB13 Antibody (NBP2-49375) (0)

There are no reviews for HOXB13 Antibody (NBP2-49375). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HOXB13 Antibody (NBP2-49375) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HOXB13 Products

Bioinformatics Tool for HOXB13 Antibody (NBP2-49375)

Discover related pathways, diseases and genes to HOXB13 Antibody (NBP2-49375). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXB13 Antibody (NBP2-49375)

Discover more about diseases related to HOXB13 Antibody (NBP2-49375).
 

Pathways for HOXB13 Antibody (NBP2-49375)

View related products by pathway.

PTMs for HOXB13 Antibody (NBP2-49375)

Learn more about PTMs related to HOXB13 Antibody (NBP2-49375).

Blogs on HOXB13

There are no specific blogs for HOXB13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXB13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXB13