HOXB7 Antibody (4C6)

Images

 
Immunohistochemistry-Paraffin: HOXB7 Antibody (4C6) [H00003217-M03] - Analysis of monoclonal antibody to HOXB7 on formalin-fixed paraffin-embedded human esophagus. Antibody concentration 1.5 ug/ml
ELISA: HOXB7 Antibody (4C6) [H00003217-M03] - Detection limit for recombinant GST tagged HOXB7 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RbSpecies Glossary
Applications WB, ELISA, Func, IHC, IHC-P
Clone
4C6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HOXB7 Antibody (4C6) Summary

Immunogen
HOXB7 (NP_004493, 55 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA
Specificity
HOXB7 - homeobox B7
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HOXB7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Functional
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for IHC-P. Use in Immunohistochemistry reported in scientific literature (PMID: 22914903).
Publications
Read Publications using
H00003217-M03 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXB7 Antibody (4C6)

  • HHO.C1
  • homeo box 2C
  • homeo box B7
  • homeo box c1 protein
  • homeobox B7
  • Homeobox protein HHO.C1
  • Homeobox protein Hox-2C
  • homeobox protein Hox-B7
  • HOX2
  • Hox-2.3
  • HOX2C
  • HOX2CHox-2.3
  • HOXB7

Background

This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003216-M01-100ug
Species: Hu
Applications: ELISA, WB
H00003204-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
233-FB/CF
Species: Hu
Applications: BA
NBP2-83058
Species: Hu
Applications: WB
212-GD/CF
Species: Hu
Applications: Bind, BA
NBP2-42520
Species: Hu, Po
Applications: IHC-P, PEP-ELISA, WB
H00005087-M01
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
H00003219-M05
Species: Hu
Applications: ChIP, ELISA, IP, S-ELISA, WB
NBP1-52085
Species: Hu, Mu
Applications: PEP-ELISA, WB
NBP2-32356
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF482
Species: Mu
Applications: IHC, WB
H00003223-M04
Species: Hu
Applications: ELISA, WB
NBP2-87596
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-24561
Species: Bv, Fe, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
314-BP/CF
Species: Hu
Applications: BA, BA
NBP2-56195
Species: Hu
Applications: ICC/IF, WB
H00003222-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, S-ELISA, WB
NBP3-06103
Species: Hu
Applications: Flow, IHC, IHC-P, WB
H00003215-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB

Publications for HOXB7 Antibody (H00003217-M03)(4)

Reviews for HOXB7 Antibody (H00003217-M03) (0)

There are no reviews for HOXB7 Antibody (H00003217-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXB7 Antibody (H00003217-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXB7 Products

Bioinformatics Tool for HOXB7 Antibody (H00003217-M03)

Discover related pathways, diseases and genes to HOXB7 Antibody (H00003217-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXB7 Antibody (H00003217-M03)

Discover more about diseases related to HOXB7 Antibody (H00003217-M03).
 

Pathways for HOXB7 Antibody (H00003217-M03)

View related products by pathway.

PTMs for HOXB7 Antibody (H00003217-M03)

Learn more about PTMs related to HOXB7 Antibody (H00003217-M03).

Blogs on HOXB7

There are no specific blogs for HOXB7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXB7 Antibody (4C6) and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXB7
Entrez
OMIM
Uniprot