HOXB6 Antibody (8E3)

Western Blot: HOXB6 Antibody (8E3) [H00003216-M01-100ug] - Detection against Immunogen (32.01 KDa)

Western Blot: HOXB6 Antibody (8E3) [H00003216-M01-100ug] - Analysis of HOXB6 expression in transfected 293T cell line by HOXB6 monoclonal antibody (M01), clone 8E3. Lane 1: HOXB6 transfected lysate (Predicted MW: 25.4 KDa). Lane 2: Non-transfected lysate.

ELISA: HOXB6 Antibody (8E3) [H00003216-M01-100ug] - Detection limit for recombinant GST tagged HOXB6 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 8E3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

HOXB6 Antibody (8E3) Summary

• Immunogen: HOXB6 (NP_724779.1, 1 a.a. ~ 57 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSS
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HOXB6
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A or G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXB6 Antibody (8E3)

• homeo box 2B
• homeo box B6
• homeobox B6
• Homeobox protein Hox-2.2
• Homeobox protein Hox-2B
• homeobox protein Hox-B6
• Homeobox protein Hu-2
• HOX2
• Hox-2.2
• HOX2BHU-2

Background

The HOXB6 gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HOXB6
• Entrez:
  • 3216(Human)
• OMIM:
  • 142961(Human)
• Uniprot:
  • NP_724779.1(Human)