HOXB6 Antibody (8E3)

Images

 
Western Blot: HOXB6 Antibody (8E3) [H00003216-M01-100ug] - Detection against Immunogen (32.01 KDa)
Western Blot: HOXB6 Antibody (8E3) [H00003216-M01-100ug] - Analysis of HOXB6 expression in transfected 293T cell line by HOXB6 monoclonal antibody (M01), clone 8E3. Lane 1: HOXB6 transfected lysate (Predicted MW: 25.4 ...read more
ELISA: HOXB6 Antibody (8E3) [H00003216-M01-100ug] - Detection limit for recombinant GST tagged HOXB6 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
8E3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HOXB6 Antibody (8E3) Summary

Immunogen
HOXB6 (NP_724779.1, 1 a.a. ~ 57 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSS
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HOXB6
Purity
Protein A or G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A or G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXB6 Antibody (8E3)

  • homeo box 2B
  • homeo box B6
  • homeobox B6
  • Homeobox protein Hox-2.2
  • Homeobox protein Hox-2B
  • homeobox protein Hox-B6
  • Homeobox protein Hu-2
  • HOX2
  • Hox-2.2
  • HOX2BHU-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003215-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
H00003217-M03
Species: Hu, Rb
Applications: ELISA, Func, IHC, IHC-P, WB
NBP2-80423
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-83058
Species: Hu
Applications: WB
H00003219-M05
Species: Hu
Applications: ChIP, ELISA, IP, S-ELISA, WB
NBP2-42520
Species: Hu, Po
Applications: IHC-P, PEP-ELISA, WB
NBP2-24561
Species: Bv, Fe, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-32515
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00003204-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP3-04877
Species: Hu, Mu, Rt
Applications: WB
NBP3-13937
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
H00003223-M04
Species: Hu
Applications: ELISA, WB
NBP2-32356
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00003213-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-80228
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-52085
Species: Hu, Mu
Applications: PEP-ELISA, WB
NBP3-16827
Species: Hu, Mu, Rt
Applications: WB
NBP2-46001
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MEP00B
Species: Mu
Applications: ELISA
NBP2-19853
Species: Hu
Applications: ChIP, ICC/IF, IP, WB

Publications for HOXB6 Antibody (H00003216-M01-100ug) (0)

There are no publications for HOXB6 Antibody (H00003216-M01-100ug).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXB6 Antibody (H00003216-M01-100ug) (0)

There are no reviews for HOXB6 Antibody (H00003216-M01-100ug). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXB6 Antibody (H00003216-M01-100ug) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXB6 Products

Array H00003216-M01-100ug

Bioinformatics Tool for HOXB6 Antibody (H00003216-M01-100ug)

Discover related pathways, diseases and genes to HOXB6 Antibody (H00003216-M01-100ug). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXB6 Antibody (H00003216-M01-100ug)

Discover more about diseases related to HOXB6 Antibody (H00003216-M01-100ug).
 

Pathways for HOXB6 Antibody (H00003216-M01-100ug)

View related products by pathway.

PTMs for HOXB6 Antibody (H00003216-M01-100ug)

Learn more about PTMs related to HOXB6 Antibody (H00003216-M01-100ug).

Blogs on HOXB6

There are no specific blogs for HOXB6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXB6 Antibody (8E3) and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXB6
Entrez
OMIM
Uniprot