HOXC9 Antibody

Images

 
Western Blot: HOXC9 Antibody [NBP2-87596] - WB Suggested Anti-HOXC9 Antibody Titration: 2.5ug/ml. Positive Control: Transfected 293T
Immunohistochemistry: HOXC9 Antibody [NBP2-87596] - Human Lung
Western Blot: HOXC9 Antibody [NBP2-87596] - Host: Rabbit. Target Name: HOXC9. Sample Tissue: Human Jurkat Whole Cell. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOXC9 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HOXC9. Peptide sequence: DRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYT The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
HOXC9
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for HOXC9 Antibody

  • homeobox C9
  • Homeobox protein Hox-3B
  • homeobox protein Hox-C9
  • HOX3
  • HOX3Bhomeo box C9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-85076
Species: Hu
Applications: WB
NBP2-42520
Species: Hu, Po
Applications: IHC-P, PEP-ELISA, WB
NBP2-45744
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-46001
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00003217-M03
Species: Hu, Rb
Applications: ELISA, Func, IHC, IHC-P, WB
NBP1-52085
Species: Hu, Mu
Applications: PEP-ELISA, WB
H00003231-M01
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP2-32356
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00003219-M05
Species: Hu
Applications: ChIP, ELISA, IP, S-ELISA, WB
H00003204-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
H00003213-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
H00003232-M09
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
H00003223-M04
Species: Hu
Applications: ELISA, WB
NBP1-83234
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-06103
Species: Hu
Applications: Flow, IHC, IHC-P, WB
H00003237-M10
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP3-17383
Species: Hu
Applications: ICC/IF, IHC, IHC-P
1845-SH/CF
Species: Hu
Applications: BA
NBP2-83058
Species: Hu
Applications: WB

Publications for HOXC9 Antibody (NBP2-87596) (0)

There are no publications for HOXC9 Antibody (NBP2-87596).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXC9 Antibody (NBP2-87596) (0)

There are no reviews for HOXC9 Antibody (NBP2-87596). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXC9 Antibody (NBP2-87596) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXC9 Products

Bioinformatics Tool for HOXC9 Antibody (NBP2-87596)

Discover related pathways, diseases and genes to HOXC9 Antibody (NBP2-87596). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXC9 Antibody (NBP2-87596)

Discover more about diseases related to HOXC9 Antibody (NBP2-87596).
 

Pathways for HOXC9 Antibody (NBP2-87596)

View related products by pathway.

PTMs for HOXC9 Antibody (NBP2-87596)

Learn more about PTMs related to HOXC9 Antibody (NBP2-87596).

Blogs on HOXC9

There are no specific blogs for HOXC9, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXC9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXC9