![Immunohistochemistry-Paraffin: Choline dehydrogenase Antibody [NBP1-87508] - Staining in human kidney and lung tissues using anti-CHDH antibody. Corresponding CHDH RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Choline-dehydrogenase-Antibody-Immunohistochemistry-Paraffin-NBP1-87508-img0006.jpg "Immunohistochemistry-Paraffin: Choline dehydrogenase Antibody [NBP1-87508] - Staining in human kidney and lung tissues using anti-CHDH antibody. Corresponding CHDH RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit Choline dehydrogenase Antibody - BSA Free (NBP1-87508) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GWMDMTIHEGKRWSAACAYLHPALSRTNLKAEAETLVSRVLFEGTRAVGVEYVKNGQSHRAYASKEVILSGGAINSPQLLMLSGIGNADDLKKLGIPV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CHDH |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Simple_Western_21377.jpg)
![Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Western_Blot_21459.jpg)
![Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Immunohistochemistry_17361.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Choline dehydrogenase Antibody (NBP1-87508)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CHDH |
![Western Blot: Choline dehydrogenase Antibody [NBP1-87508] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue](http://images.novusbio.com/fullsize/Choline-dehydrogenase-Antibody-Western-Blot-NBP1-87508-img0004.jpg "Western Blot: Choline dehydrogenase Antibody [NBP1-87508] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue")
![Immunohistochemistry-Paraffin: Choline dehydrogenase Antibody [NBP1-87508] - Staining of human lung shows low expression as expected.](http://images.novusbio.com/fullsize/Choline-dehydrogenase-Antibody-Immunohistochemistry-Paraffin-NBP1-87508-img0005.jpg "Immunohistochemistry-Paraffin: Choline dehydrogenase Antibody [NBP1-87508] - Staining of human lung shows low expression as expected.")
![Immunohistochemistry: Choline dehydrogenase Antibody [NBP1-87508] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.](http://images.novusbio.com/fullsize/Choline-dehydrogenase-Antibody-Immunohistochemistry-NBP1-87508-img0003.jpg "Immunohistochemistry: Choline dehydrogenase Antibody [NBP1-87508] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.")
![Chordin [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Chordin [Unconjugated]")
![SDS-PAGE BMP-4 [Unconjugated]](https://images.novusbio.com/images2/BMP-4_314-BP_100.jpg)
![Bioactivity BMP-4 [Unconjugated]](https://images.novusbio.com/images2/314-bp_recombinant-human-bmp-4-protein-1882021123744.jpg)
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/BRCA2_MAB2476_Western_Blot_6033.jpg)
![Immunohistochemistry BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/mab2476_human-brca2-mab-clone-234403-immunohistochemistry-10520211657.jpg)
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images/mab2476_human-brca2-mab-clone-234403-2282024172111.jpg)
![Immunohistochemistry Crossveinless-2/CV-2/BMPER Antibody [Unconjugated]](https://images.novusbio.com/images2/Crossveinless-2_AF2299_Immunohistochemistry_10691.jpg)
![Immunocytochemistry/ Immunofluorescence Crossveinless-2/CV-2/BMPER Antibody [Unconjugated]](https://images.novusbio.com/images/af2299_mouse-crossveinless-2-affinity-purified-polyclonal-ab-41202412405112.jpg)
![Immunocytochemistry/ Immunofluorescence Crossveinless-2/CV-2/BMPER Antibody [Unconjugated]](https://images.novusbio.com/images/af2299_mouse-crossveinless-2-affinity-purified-polyclonal-ab-41202412403561.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")