Choline dehydrogenase Antibody

Images

 
Western Blot: Choline dehydrogenase Antibody [NBP1-87508] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Immunohistochemistry: Choline dehydrogenase Antibody [NBP1-87508] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Choline dehydrogenase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GWMDMTIHEGKRWSAACAYLHPALSRTNLKAEAETLVSRVLFEGTRAVGVEYVKNGQSHRAYASKEVILSGGAINSPQLLMLSGIGNADDLKKLGIPV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHDH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Choline dehydrogenase Protein (NBP1-87508PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Choline dehydrogenase Antibody

  • CDH
  • CHD
  • choline dehydrogenase
  • choline dehydrogenase, mitochondrial
  • EC 1.1.99.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NLS1436
Species: Hu
Applications: IHC-P
NBP1-59580
Species: Hu, Rt
Applications: WB
NBP2-15343
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2476
Species: Hu
Applications: WB, IHC
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP2-03376
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02349
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00001491-M01
Species: Hu, GP
Applications: WB, ELISA
NBP1-78444
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1207
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF2299
Species: Mu
Applications: WB, IHC
H00000875-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, IP, RNAi

Publications for Choline dehydrogenase Antibody (NBP1-87508) (0)

There are no publications for Choline dehydrogenase Antibody (NBP1-87508).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Choline dehydrogenase Antibody (NBP1-87508) (0)

There are no reviews for Choline dehydrogenase Antibody (NBP1-87508). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Choline dehydrogenase Antibody (NBP1-87508) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Choline dehydrogenase Products

Bioinformatics Tool for Choline dehydrogenase Antibody (NBP1-87508)

Discover related pathways, diseases and genes to Choline dehydrogenase Antibody (NBP1-87508). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Choline dehydrogenase Antibody (NBP1-87508)

Discover more about diseases related to Choline dehydrogenase Antibody (NBP1-87508).
 

Pathways for Choline dehydrogenase Antibody (NBP1-87508)

View related products by pathway.

PTMs for Choline dehydrogenase Antibody (NBP1-87508)

Learn more about PTMs related to Choline dehydrogenase Antibody (NBP1-87508).
 

Research Areas for Choline dehydrogenase Antibody (NBP1-87508)

Find related products by research area.

Blogs on Choline dehydrogenase

There are no specific blogs for Choline dehydrogenase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Choline dehydrogenase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHDH