HOMER2 Antibody

Images

 
Western Blot: HOMER2 Antibody [NBP1-85487] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: HOMER2 Antibody [NBP1-85487] - Staining of human cell line U-251 MG shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: HOMER2 Antibody [NBP1-85487] - Staining of human pancreas shows strong cytoplasmic and membranous positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOMER2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IIPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRGLSKLGTDN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HOMER2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HOMER2 Protein (NBP1-85487PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HOMER2 Antibody

  • ACPD
  • CPD
  • cupidin
  • homer homolog 2 (Drosophila)
  • homer homolog 3
  • homer protein homolog 2
  • homer, neuronal immediate early gene, 2
  • HOMER-2
  • HOMER2A
  • HOMER-2A
  • HOMER2B
  • HOMER-2B
  • Vesl-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00065057-M02
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF2180
Species: Hu
Applications: WB, Simple Western, IP
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NB100-74457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
MAB4514
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-39033
Species: Hu, Mu, Rt, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-44999
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-477
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00284131-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HOMER2 Antibody (NBP1-85487) (0)

There are no publications for HOMER2 Antibody (NBP1-85487).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOMER2 Antibody (NBP1-85487) (0)

There are no reviews for HOMER2 Antibody (NBP1-85487). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HOMER2 Antibody (NBP1-85487) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOMER2 Products

Bioinformatics Tool for HOMER2 Antibody (NBP1-85487)

Discover related pathways, diseases and genes to HOMER2 Antibody (NBP1-85487). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOMER2 Antibody (NBP1-85487)

Discover more about diseases related to HOMER2 Antibody (NBP1-85487).
 

Pathways for HOMER2 Antibody (NBP1-85487)

View related products by pathway.

PTMs for HOMER2 Antibody (NBP1-85487)

Learn more about PTMs related to HOMER2 Antibody (NBP1-85487).

Blogs on HOMER2

There are no specific blogs for HOMER2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOMER2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOMER2