hnRNP H2 Antibody

Images

 
Western Blot: hnRNP H2 Antibody [NBP2-55194] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: hnRNP H2 Antibody [NBP2-55194] - Staining of human cell line U-251 MG shows localization to nucleoplasm.
Western Blot: hnRNP H2 Antibody [NBP2-55194] - Analysis in human cell line HeLa.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

hnRNP H2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DGRVTGEADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQ
Specificity
Specificity of human hnRNP H2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HNRNPH2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
hnRNP H2 Recombinant Protein Antigen (NBP2-55194PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for hnRNP H2 Antibody

  • FTP-3
  • FTP3hnRNP H2
  • Heterogeneous nuclear ribonucleoprotein H'
  • heterogeneous nuclear ribonucleoprotein H2 (H')
  • heterogeneous nuclear ribonucleoprotein H2
  • hnRNP H'
  • hnRNPH'
  • HNRPH'
  • HNRPH2heterogeneous nuclear ribonucleoprotein H-prime

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32173
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IP
NB100-2737
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB7619
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-85273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-316
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb
Applications: WB, Simple Western, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-80754
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88027
Species: Hu, Mu, Rt, Eq
Applications: WB, Simple Western, IHC, IHC-P
NBP2-16576
Species: Hu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-75478
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-85296
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24531
Species: Hu, Mu, Rt, Ma-Op, Pm
Applications: WB, IHC, IHC-P
NBP1-86962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NBP2-24531
Species: Hu, Mu, Rt, Ma-Op, Pm
Applications: WB, IHC, IHC-P
NB100-385
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-55194
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for hnRNP H2 Antibody (NBP2-55194) (0)

There are no publications for hnRNP H2 Antibody (NBP2-55194).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for hnRNP H2 Antibody (NBP2-55194) (0)

There are no reviews for hnRNP H2 Antibody (NBP2-55194). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for hnRNP H2 Antibody (NBP2-55194) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional hnRNP H2 Products

Bioinformatics Tool for hnRNP H2 Antibody (NBP2-55194)

Discover related pathways, diseases and genes to hnRNP H2 Antibody (NBP2-55194). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for hnRNP H2 Antibody (NBP2-55194)

Discover more about diseases related to hnRNP H2 Antibody (NBP2-55194).
 

Pathways for hnRNP H2 Antibody (NBP2-55194)

View related products by pathway.

PTMs for hnRNP H2 Antibody (NBP2-55194)

Learn more about PTMs related to hnRNP H2 Antibody (NBP2-55194).

Blogs on hnRNP H2

There are no specific blogs for hnRNP H2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our hnRNP H2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HNRNPH2