hnRNP H2 Antibody

Images

 
Western Blot: hnRNP H2 Antibody [NBP1-89817] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: hnRNP H2 Antibody [NBP1-89817] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli and cytoskeleton (actin filaments).
Immunohistochemistry-Paraffin: hnRNP H2 Antibody [NBP1-89817] - Staining of human duodenum shows strong nuclear positivity in glandular cells.
Western Blot: hnRNP H2 Antibody [NBP1-89817] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

hnRNP H2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DGRVTGEADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HNRNPH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
hnRNP H2 Protein (NBP1-89817PEP)
Publications
Read Publication using
NBP1-89817 in the following applications:

  • 1 publication
  • IP
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24644279).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for hnRNP H2 Antibody

  • FTP-3
  • FTP3hnRNP H2
  • Heterogeneous nuclear ribonucleoprotein H'
  • heterogeneous nuclear ribonucleoprotein H2 (H')
  • heterogeneous nuclear ribonucleoprotein H2
  • hnRNP H'
  • hnRNPH'
  • HNRPH'
  • HNRPH2heterogeneous nuclear ribonucleoprotein H-prime

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32173
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29461
Species: Hu, Bv(-), Ca(-), Ha(-), Mu(-), Po(-), Rt(-), Sh(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-85273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-316
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb
Applications: WB, Simple Western, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-80754
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF6146
Species: Hu
Applications: ICC
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP1-30975
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02316
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NBP1-30975
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-385
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89817
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for hnRNP H2 Antibody (NBP1-89817)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: ICC/IF, IP, WB.


Filter By Application
ICC/IF
(1)
IP
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for hnRNP H2 Antibody (NBP1-89817) (0)

There are no reviews for hnRNP H2 Antibody (NBP1-89817). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for hnRNP H2 Antibody (NBP1-89817) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional hnRNP H2 Products

Bioinformatics Tool for hnRNP H2 Antibody (NBP1-89817)

Discover related pathways, diseases and genes to hnRNP H2 Antibody (NBP1-89817). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for hnRNP H2 Antibody (NBP1-89817)

Discover more about diseases related to hnRNP H2 Antibody (NBP1-89817).
 

Pathways for hnRNP H2 Antibody (NBP1-89817)

View related products by pathway.

PTMs for hnRNP H2 Antibody (NBP1-89817)

Learn more about PTMs related to hnRNP H2 Antibody (NBP1-89817).

Blogs on hnRNP H2

There are no specific blogs for hnRNP H2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our hnRNP H2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HNRNPH2