HMGCS2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: HMGCS2 Antibody [NBP3-35423] - Immunofluorescence analysis of paraffin-embedded rat liver using HMGCS2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: HMGCS2 Antibody [NBP3-35423] - Immunofluorescence analysis of paraffin-embedded mouse liver using HMGCS2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: HMGCS2 Antibody [NBP3-35423] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using HMGCS2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: HMGCS2 Antibody [NBP3-35423] - Immunofluorescence analysis of paraffin-embedded human liver using HMGCS2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: HMGCS2 Antibody [NBP3-35423] - Western Blot analysis of various lysates using HMGCS2 Rabbit pAb at 1:7000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates / proteins: 25 ug per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Immunocytochemistry/ Immunofluorescence: HMGCS2 Antibody [NBP3-35423] - Immunofluorescence analysis of paraffin-embedded mouse liver using HMGCS2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HMGCS2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HMGCS2 Antibody - BSA Free (NBP3-35423) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 269-508 of human HMGCS2 (NP_005509.1).
  
  Sequence:
  CYTSYRKKIQNQWKQAGSDRPFTLDDLQYMIFHTPFCKMVQKSLARLMFNDFLSASSDTQTSLYKGLEAFGGLKLEDTYTNKDLDKALLKASQDMFDKKTKASLYLSTHNGNMYTSSLYGCLASLLSHHSAQELAGSRIGAFSYGSGLAASFFSFRVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLERVDEQHRRKYARRPV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HMGCS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:100
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:100
  • Western Blot 1:2000 - 1:8000
• Theoretical MW: 57 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for HMGCS2 Antibody - BSA Free

• 3-hydroxy-3-methylglutaryl coenzyme A synthase
• 3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial)
• 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 (mitochondrial)
• EC 2.3.3.10
• HMG-CoA synthase
• hydroxymethylglutaryl-CoA synthase, mitochondrial
• mitochondrial 3-hydroxy-3-methylglutaryl-CoA synthase

Background

HMGCS2 is an enzyme that condenses acetyl CoA with acetoacetyl CoA to form HMG CoA, which is the substrate for HMG CoA reductase. Together with HMG CoA lyase, it is responsible for ketone body biosynthesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HMGCS2