GGPS1 Antibody - BSA Free

Images

 
Western Blot: GGPS1 Antibody [NBP1-83368] - Analysis in control (vector only transfected HEK293T lysate) and GGPS1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: GGPS1 Antibody [NBP1-83368] - Staining of human liver shows no positivity in hepatocytes as expected.
Western Blot: GGPS1 Antibody [NBP1-83368] - Analysis in human cell line RT-4.
Orthogonal Strategies: Immunohistochemistry-Paraffin: GGPS1 Antibody [NBP1-83368] - Analysis in human testis and skeletal muscle tissues. Corresponding GGPS1 RNA-seq data are presented for the same tissues.
Staining of human skeletal muscle shows no positivity in myocytes as expected.
Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

GGPS1 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit GGPS1 Antibody - BSA Free (NBP1-83368) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKE
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GGPS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GGPS1 Protein (NBP1-83368PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GGPS1 Antibody - BSA Free

  • 6E)-farnesyl diphosphate synthase
  • dimethylallyltranstransferase
  • EC 2.5.1.1
  • EC 2.5.1.10
  • EC 2.5.1.29
  • Farnesyl diphosphate synthase
  • Farnesyltranstransferase
  • geranylgeranyl diphosphate synthase 1
  • Geranylgeranyl diphosphate synthase
  • geranylgeranyl pyrophosphate synthase
  • geranyltranstransferase
  • GGPP synthase
  • GGPPS
  • GGPPS1farnesyltranstransferase
  • GGPPSase

Background

GGPS1 is a member of the prenyltransferase family and encodes a protein with geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16463
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-85445
Species: Hu
Applications: IHC,  IHC-P
NB100-56749
Species: Hu, Mu, Rb, Rt
Applications: IHC, IHC-Fr,  IHC-P, WB
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP2-16984
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-31475
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF1095
Species: Hu
Applications: CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP2-01170
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-664
Species: Ca, Hu, Mu, Po, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
MAB6460
Species: Hu
Applications: IHC, WB
NBP1-83368
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for GGPS1 Antibody (NBP1-83368) (0)

There are no publications for GGPS1 Antibody (NBP1-83368).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GGPS1 Antibody (NBP1-83368) (0)

There are no reviews for GGPS1 Antibody (NBP1-83368). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GGPS1 Antibody (NBP1-83368) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GGPS1 Products

Research Areas for GGPS1 Antibody (NBP1-83368)

Find related products by research area.

Blogs on GGPS1

There are no specific blogs for GGPS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GGPS1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol GGPS1