GGPS1 Antibody

Images

 
Western Blot: GGPS1 Antibody [NBP1-83368] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: GGPS1 Antibody [NBP1-83368] - Staining of human testis shows distinct cytoplasmic positivity in seminiferus duct cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GGPS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GGPS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GGPS1 Protein (NBP1-83368PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GGPS1 Antibody

  • 6E)-farnesyl diphosphate synthase
  • dimethylallyltranstransferase
  • EC 2.5.1.1
  • EC 2.5.1.10
  • EC 2.5.1.29
  • Farnesyl diphosphate synthase
  • Farnesyltranstransferase
  • geranylgeranyl diphosphate synthase 1
  • Geranylgeranyl diphosphate synthase
  • geranylgeranyl pyrophosphate synthase
  • geranyltranstransferase
  • GGPP synthase
  • GGPPS
  • GGPPS1farnesyltranstransferase
  • GGPPSase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16463
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-16984
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31475
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-01170
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB6460
Species: Hu
Applications: WB, IHC
NBP1-83368
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for GGPS1 Antibody (NBP1-83368) (0)

There are no publications for GGPS1 Antibody (NBP1-83368).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GGPS1 Antibody (NBP1-83368) (0)

There are no reviews for GGPS1 Antibody (NBP1-83368). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GGPS1 Antibody (NBP1-83368) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GGPS1 Products

Bioinformatics Tool for GGPS1 Antibody (NBP1-83368)

Discover related pathways, diseases and genes to GGPS1 Antibody (NBP1-83368). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GGPS1 Antibody (NBP1-83368)

Discover more about diseases related to GGPS1 Antibody (NBP1-83368).
 

Pathways for GGPS1 Antibody (NBP1-83368)

View related products by pathway.

PTMs for GGPS1 Antibody (NBP1-83368)

Learn more about PTMs related to GGPS1 Antibody (NBP1-83368).

Blogs on GGPS1

There are no specific blogs for GGPS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GGPS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GGPS1