Home » HMG-CoA Reductase/HMGCR » HMG-CoA Reductase/HMGCR Proteins » HMG-CoA Reductase/HMGCR Recombinant Protein Antigen

HMG-CoA Reductase/HMGCR Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for HMG-CoA Reductase/HMGCR Recombinant Protein Antigen (NBP1-91996PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

HMG-CoA Reductase/HMGCR Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HMGCR.

Source: E.coli

Amino Acid Sequence: MAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQG
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HMGCR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-91996.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for HMG-CoA Reductase/HMGCR Recombinant Protein Antigen

  • 3-hydroxy-3-methylglutaryl CoA reductase (NADPH)
  • 3-hydroxy-3-methylglutaryl-CoA reductase
  • 3-hydroxy-3-methylglutaryl-Coenzyme A reductase
  • EC 1.1.1
  • EC 1.1.1.34
  • HMG-CoA Reductase
  • HMGCR
  • Hydroxymethylglutaryl-CoA Reductase
  • LDLCQ3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

LDL R Antibody (C7)
NBP1-78159
Western Blot: LDL R Antibody (C7) [NBP1-78159] - Total protein from human HeLa and HepG2 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 0.5 ug/ml anti-LDL receptor in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: LDL R Antibody (C7) [NBP1-78159] - Image from a customer review on porcine intestinal epithelial cells IPEC-J2.
Immunohistochemistry: LDL R Antibody (C7) [NBP1-78159] - IHC analysis of a formalin fixed paraffin embedded tissue section of human liver using LDL Receptor antibody (clone C7) with HRP-DAB based detection and hematoxylin counterstaining.
(1 Review)
(17 Publications)
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
CYP7A1 Antibody
(946902) [Unconjugate
MAB9120
CYP7A1 was detected in immersion fixed human hepatocytes induced with dexamethasone for 48 hours using Mouse Anti-Human CYP7A1 Polyclonal Antibody (Catalog # MAB9120) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (green). Specific staining was localized to endoplasmic reticula and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: ICC
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(21 Reviews)
(526 Publications)
Species: Hu
ACAT1 Antibody
NBP1-89284
Western Blot: ACAT1 Antibody [NBP1-89284] - ACAT1 porcine cerebral cortex. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: ACAT1 Antibody [NBP1-89284] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89284] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
(1 Review)
(5 Publications)
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
SDS-Page: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260]
(4 Reviews)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
CES1 Antibody
NBP1-85691
Western Blot: CES1 Antibody [NBP1-85691] - Analysis in human cell line HepG2.
Immunohistochemistry-Paraffin: CES1 Antibody [NBP1-85691] - Staining in human liver and kidney tissues using anti-CES1 antibody. Corresponding CES1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CES1 Antibody [NBP1-85691] - Staining of human kidney shows low expression as expected.
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
ACAT Antibody
NB400-141
ACAT Antibody
(4 Publications)
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
SREBP2 Antibody
(1D2)
NBP1-54446
Western Blot: SREBP2 Antibody (1D2) [NBP1-54446] - Lane1: HEp-2 cells. Lane 2: MCF-7 cells. Lane 3: LNCaP cells. Lane 4: HT1080 cells. Lane5 ZR75-1 cells.
Immunocytochemistry/Immunofluorescence: SREBP2 Antibody (1D2) [NBP1-54446] - SREBP2 (1D2) antibody was tested in HeLa cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(14 Publications)
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
Cytochrome P450
3A4 Antibody (3H8)
NBP2-37502
Western Blot: Cytochrome P450 3A4 Antibody (3H8) [NBP2-37502] - Western blot analysis using CYP3A4 mAb against HEK293 (1) and CYP3A4 (AA: 243-430)-hIgGFc transfected HEK293 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: Cytochrome P450 3A4 Antibody (3H8) [NBP2-37502] - Immunofluorescence analysis of HepG2 cells using CYP3A4 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry: Cytochrome P450 3A4 Antibody (3H8) [NBP2-37502] - Immunohistochemical analysis of paraffin-embedded human brain tissues using CYP3A4 mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
FDPS Antibody
NBP2-16463
Western Blot: FDPS Antibody [NBP2-16463] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with FDPS antibody [N1C3] diluted at 1:3000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: FDPS Antibody [NBP2-16463] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: FDPS protein stained by FDPS antibody [N1C3] diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: FDPS Antibody [NBP2-16463] - Paraffin-embedded mouse kidney. FDPS antibody [N1C3] dilution: 1:500.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
SREBP1 Antibody
(2A4)
NB600-582
Western Blot: SREBP1 Antibody (2A4) [NB600-582] - Analysis of whole cell lysate from HeLa cells showing a single specific band for the expression of SREBP1 precursor protein (~120 kDa).
Simple Western: SREBP1 Antibody (2A4) [NB600-582] - Lane view shows a specific band for SREBP1 in 1.0 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(28 Publications)
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western, IHC
eNOS Antibody
NB300-500
Immunohistochemistry: eNOS Antibody [NB300-500] - The pulmonary tissues were analyzed for expression of eNOS protein by immunohistochemistry(IHC). Dark brown staining of indicates eNOS-positive cells. IHC stain of representative pulmonary artery endothelial cells from rats subjected to CON=Control Group, ALI=Acute lung injury Group, LV=Low tidal volume Group, VLV=Very low tidal volume Group, MV=Large tidal volume Group (magnification, x400).
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Staining of eNOS in human lung tissue.
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Mouse Carotid Artery stained with eNOS antibody. Image from verified customer review.
(3 Reviews)
(12 Publications)
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
Rhodopsin Antibody
(A531)
NBP2-25159
Western Blot: Rhodopsin Antibody (A531) [NBP2-25159] - Blot of bovine retinal extracts. The antibody stains a band corresponing to retinal Rhodopsin at about 35kDa. Bands about 70 kDa and 140 kDa are aggregated forms of Rhodopsin. Note, due to the highly hydrophobic nature of Rhodopsin, it is important not to boil a sample containing it in SDS-PAGE sample buffer, as this will result in more extensive aggregation of the Rhodopsin protein.
Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (A531) [NBP2-25159] - Pig retinal section stained with NBP2-25159 (green) and counterstained with rabbit polyclonal antibody to NF-M NB300-133 (red) and DNA (blue). Rhodopsin is most abundant in the outer segments of retina (OS), NF-M is abundant in the optic nerve fiber layer (ONFL), but seen in processes and neurons in other regions also. Other layers are pigmented epithelium (PE), outer and inner nuclear layers (ONL, INL), outer and inner plexiform layers (OPL, IPL) and ganglion cell layer (GCL).
(1 Publication)
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
RhoD Antibody
NBP1-58359
Western Blot: RhoD Antibody [NBP1-58359] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry: RhoD Antibody [NBP1-58359] - Human Liver Tissue Observed Staining: Cytoplasm in sinusoids of liver Primary Antibody Concentration: 1 : 100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Expos
Immunohistochemistry-Paraffin: RhoD Antibody [NBP1-58359] - Human Tonsil Tissue, 4-8ug/ml.
Species: Hu
Applications: WB, IHC, IHC-P
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.
Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human liver shows low expression as expected.
Immunohistochemistry: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human adrenal gland shows high expression.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Fatty Acid
Synthase/FASN Antibod
NB400-114
Western Blot: Fatty Acid Synthase Antibody [NB400-114] - Expression of Fatty Acid Synthase in chicken hypothalamus. A: total RNA (1 ug) isolated from different tissues (brain, hypothalamus, liver and muscle) was subjected to RT-PCR using specific primers for chicken Fatty Acid Synthase (GenBank accession JO4485) or ribosomal 18S as a control (GenBank accession AF173612) B: tissue lysates (brain, hypothalmus, liver and muscle) were subjected to Western blot as described in MATERIALS AND METHODS. Blots were incubated with anti-Fatty Acid Synthase antibody and revealed by enhanced chemiluminescence. Picture compliments of Dridi S. et al, Am J Physiol Regul Integr Comp Physiol. 2006 Jul;291(1):R138-47. Epub 2006 Feb 2.
Immunocytochemistry/Immunofluorescence: Fatty Acid Synthase Antibody [NB400-114] - The Fas antibody was tested in MCF-7 cells at a 1:2000 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 550 (Red) and DAPI (Blue), respectively.
Immunohistochemistry-Paraffin: Fatty Acid Synthase Antibody [NB400-114] - Immunohistochemical localization of FAS in chicken hypothalmus. Paraffin sections were obtained from 3-wk-old broiler chickens.
(2 Reviews)
(19 Publications)
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Thyroglobulin
Antibody (2H11+6E1)
NBP2-34294
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11+6E1) [NBP2-34294] - Thyroglobulin staining in thyroid tissue of normal C57 mouse (Red). Dilution is 1:100. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11+6E1) [NBP2-34294] - Analysis using Azide/BSA FREE version of NBP2-34294. Human Thyroid stained with Thyroglobulin Ab (2H11 + 6E1).
Immunohistochemistry: Thyroglobulin Antibody (2H11+6E1) [NBP2-34294] - Imaging of Mouse stomach tissue. Positive staining can only be observed inside the thyroid cells and the follicle in thyroid tissue. This image was submitted via customer Review.
(2 Reviews)
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
FDFT1 Antibody
(OTI2F10)
NBP2-01170
Western Blot: FDFT1 Antibody (2F10) [NBP2-01170] Analysis of extracts (35ug) from 9 different cell lines by using anti-FDFT1 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: FDFT1 Antibody (2F10) [NBP2-01170] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY FDFT1.
Immunohistochemistry-Paraffin: FDFT1 Antibody (2F10) [NBP2-01170] - Staining of paraffin-embedded Human prostate tissue using anti-FDFT1 mouse monoclonal antibody.
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
ACE/CD143 Antibody
[Unconjugated]
AF1513
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(1 Review)
(3 Publications)
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
HMG-CoA
Reductase/HMGCR Recom ...
NBP1-91996PEP
HMG-CoA Reductase/HMGCR Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for HMG-CoA Reductase/HMGCR Recombinant Protein Antigen (NBP1-91996PEP) (0)

There are no publications for HMG-CoA Reductase/HMGCR Recombinant Protein Antigen (NBP1-91996PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HMG-CoA Reductase/HMGCR Recombinant Protein Antigen (NBP1-91996PEP) (0)

There are no reviews for HMG-CoA Reductase/HMGCR Recombinant Protein Antigen (NBP1-91996PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for HMG-CoA Reductase/HMGCR Recombinant Protein Antigen (NBP1-91996PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for HMG-CoA Reductase/HMGCR Recombinant Protein Antigen (NBP1-91996PEP)

Discover related pathways, diseases and genes to HMG-CoA Reductase/HMGCR Recombinant Protein Antigen (NBP1-91996PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HMG-CoA Reductase/HMGCR Recombinant Protein Antigen (NBP1-91996PEP)

Discover more about diseases related to HMG-CoA Reductase/HMGCR Recombinant Protein Antigen (NBP1-91996PEP).
 

Pathways for HMG-CoA Reductase/HMGCR Recombinant Protein Antigen (NBP1-91996PEP)

View related products by pathway.

PTMs for HMG-CoA Reductase/HMGCR Recombinant Protein Antigen (NBP1-91996PEP)

Learn more about PTMs related to HMG-CoA Reductase/HMGCR Recombinant Protein Antigen (NBP1-91996PEP).

Blogs on HMG-CoA Reductase/HMGCR

There are no specific blogs for HMG-CoA Reductase/HMGCR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
TNF-alpha [Unconjugated]
210-TA-005
Immunohistochemistry-Paraffin: HMG-CoA Reductase/HMGCR Antibody [NBP1-91996] - Staining of human skin shows moderate to strong cytoplasmic positivity in epidermal cells.
HMG-CoA Reductase/HMGCR Antibody
NBP1-91996
Western Blot: SREBP1 Antibody (2A4) [NB600-582] - Analysis of whole cell lysate from HeLa cells showing a single specific band for the expression of SREBP1 precursor protein (~120 kDa).
SREBP1 Antibody (2A4)
NB600-582
Western Blot: Fatty Acid Synthase Antibody [NB400-114] - Expression of Fatty Acid Synthase in chicken hypothalamus. A: total RNA (1 ug) isolated from different tissues (brain, hypothalamus, liver and muscle) was subjected to RT-PCR using specific primers for chicken Fatty Acid Synthase (GenBank accession JO4485) or ribosomal 18S as a control (GenBank accession AF173612) B: tissue lysates (brain, hypothalmus, liver and muscle) were subjected to Western blot as described in MATERIALS AND METHODS. Blots were incubated with anti-Fatty Acid Synthase antibody and revealed by enhanced chemiluminescence. Picture compliments of Dridi S. et al, Am J Physiol Regul Integr Comp Physiol. 2006 Jul;291(1):R138-47. Epub 2006 Feb 2.
Fatty Acid Synthase/FASN Antibody
NB400-114

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HMG-CoA Reductase/HMGCR Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol HMGCR