HMBOX1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: HMBOX1 Antibody [NBP2-58377] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.

• Reactivity: Hu, Mu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HMBOX1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HMBOX1 Antibody - BSA Free (NBP2-58377) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IKRRANIEAAILESHGIDVQSPGGHSNSDDVDGNDYSEQDDSTSHSDHQDPISLAVEMAAVNHTILALARQGANEIKTEALDD
• Predicted Species: Mouse (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HMBOX1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HMBOX1 Recombinant Protein Antigen (NBP2-58377PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HMBOX1 Antibody - BSA Free

• FLJ21616
• HNF1LA
• homeobox containing 1
• homeobox-containing protein 1
• homeobox-containing protein PBHNF
• PBHNF

Background

HMBOX1, also known as Homeobox-containing protein 1, is a 47kDa 429 amino acid protein with four isoforms produced by alternative splicing. The gene can be found in the nucleus and the cytoplasm where it acts as a transcriptional repressor. Current research on HMBOX1 is being conducted in relation to bronchopulmonary dysplasia, immunodeficiency and prostatitis. HMBOX1 is linked to the MRNA splicing, nuclear transport, stem cell differentiation, tube formation and transport pathways where it interacts with SUMO2 and ENTPD2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HMBOX1