MEOX 2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: MEOX 2 Antibody [NBP2-30647] - Analysis in human placenta and prostate tissues using antibody. Corresponding MEOX2 RNA-seq data are presented for the same ...read more
Western Blot: MEOX 2 Antibody [NBP2-30647] - Analysis in control (vector only transfected HEK293T lysate) and MEOX2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: MEOX 2 Antibody [NBP2-30647] - Staining of human placenta shows strong nuclear positivity in endothelial cells.
Immunohistochemistry-Paraffin: MEOX 2 Antibody [NBP2-30647] - Staining of human liver shows no positivity in hepatocytes as expected
Immunohistochemistry-Paraffin: MEOX 2 Antibody [NBP2-30647] - Staining of human cerebral cortex shows no positivity in neurons as expected
Immunohistochemistry-Paraffin: MEOX 2 Antibody [NBP2-30647] - Staining of human prostate shows no positivity in glandular cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

MEOX 2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPELGSSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEAEKRSGGKR
Marker
Mesoderm Marker
Predicted Species
Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MEOX2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MEOX 2 Protein (NBP2-30647PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MEOX 2 Antibody

  • growth arrest-specific homeo box
  • Growth arrest-specific homeobox
  • homeobox protein MOX-2
  • mesenchyme homeo box 2 (growth arrest-specific homeo box)
  • mesenchyme homeobox 2GAX
  • MOX2mesenchyme homeobox 2 (growth arrest-specific homeo box)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2724
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-76302
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-45041
Species: Hu, Po
Applications: Flow, ICC/IF, IF
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Func, IHC, IHC-Fr, IHC-P
MAB4027
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NB100-56511
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
NBP1-89719
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67484
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-30647
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for MEOX 2 Antibody (NBP2-30647) (0)

There are no publications for MEOX 2 Antibody (NBP2-30647).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEOX 2 Antibody (NBP2-30647) (0)

There are no reviews for MEOX 2 Antibody (NBP2-30647). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MEOX 2 Antibody (NBP2-30647) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MEOX 2 Products

Bioinformatics Tool for MEOX 2 Antibody (NBP2-30647)

Discover related pathways, diseases and genes to MEOX 2 Antibody (NBP2-30647). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEOX 2 Antibody (NBP2-30647)

Discover more about diseases related to MEOX 2 Antibody (NBP2-30647).
 

Pathways for MEOX 2 Antibody (NBP2-30647)

View related products by pathway.

PTMs for MEOX 2 Antibody (NBP2-30647)

Learn more about PTMs related to MEOX 2 Antibody (NBP2-30647).

Blogs on MEOX 2

There are no specific blogs for MEOX 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEOX 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MEOX2
Uniprot