HLA DQA1 Antibody - BSA Free

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human lung shows strong cytoplasmic positivity in macrophages.

Analysis in human tonsil and skeletal muscle tissues using HPA012315 antibody. Corresponding HLA-DQA1 RNA-seq data are presented for the same tissues.

Staining of human small intestine shows strong cytoplasmic positivity in lymphoid cells.

Staining of human tonsil shows strong membranous positivity in germinal center cells.

Analysis in human cell line HDLM-2.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HLA DQA1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HLA DQA1 Antibody - BSA Free (NBP1-84550) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DHVASCGVNLYQFYGPSGQYTHEFDGDEQFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATNEVPEVTVFSKSPVTLGQPNTLI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HLA-DQA1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HLA DQA1 Protein (NBP1-84550PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HLA DQA1 Antibody - BSA Free

• CD
• CELIAC1DQ alpha 1 chain
• DC-1 alpha chain
• DQ-A1
• FLJ27088
• FLJ27328
• GSE
• HLA class II histocompatibility antigen, DQ(W3) alpha chain
• HLA-DCA
• HLA-DQA
• leucocyte antigen DQA1
• leukocyte antigen alpha chain
• major histocompatibility complex, class II, DQ alpha 1
• MGC149527
• MHC class II antigen
• MHC class II DQA1
• MHC class II HLA-D alpha glycoprotein
• MHC class II HLA-DQ-alpha-1
• MHC class II surface glycoprotein
• MHC HLA-DQ alpha

Background

HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B Lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HLA-DQA1