HLA DMB Antibody - BSA Free

Immunohistochemistry-Paraffin: HLA DMB Antibody [NBP1-85326] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HLA DMB Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HLA DMB Antibody - BSA Free (NBP1-85326) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HLA-DMB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HLA DMB Recombinant Protein Antigen (NBP1-85326PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HLA DMB Antibody - BSA Free

• class II histocompatibility antigen, M beta chain
• D6S221E
• DMB
• major histocompatibility complex, class II, DM beta
• MHC class II antigen DMB
• MHC class II antigen HLA-DM beta chain
• MHC class II HLA-DMB
• Really interesting new gene 7 protein
• RING7HLA class II histocompatibility antigen, DM beta chain

Background

HLA-DMB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta (DMB) chain, both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP (class II-associated invariant chain peptide) molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for HLA DMB Antibody (NBP1-85326). (Showing 1 - 1 of 1 FAQ).

1. We are planning to buy the HLA-DPA1 and HLA-DMB Abs from your company to do the IHC in our Tumor samples. We saw the image of the tissue, and my PI wants to know if you can send us the exact protocol you have used to do the IHC for NBP2-16851 and NBP1-85326?
   • These two antibodies should work with any general IHC-P protocol. Our general IHC-P protocol can be found here.

Bioinformatics

• Gene Symbol: HLA-DMB