HLA B Antibody - BSA Free

Images

 
Immunohistochemistry: HLA B Antibody [NBP3-35277] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen using HLA B Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with ...read more
Immunohistochemistry: HLA B Antibody [NBP3-35277] - Immunohistochemistry analysis of paraffin-embedded Human esophageal using HLA B Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with ...read more
Immunohistochemistry: HLA B Antibody [NBP3-35277] - Immunohistochemistry analysis of paraffin-embedded Rat spleen using HLA B Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M ...read more
Western Blot: HLA B Antibody [NBP3-35277] - Western Blot analysis of various lysates using HLA B Rabbit pAb at 1:3000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

HLA B Antibody - BSA Free Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HLA B (NP_005505.2).

Sequence:
MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HLA-B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:1000 - 1:2000
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for HLA B Antibody - BSA Free

  • ankylosing spondylitis
  • AS
  • B-4901
  • b'DT
  • Bw-22
  • Bw-4
  • Bw-41
  • Bw-44
  • Bw-45
  • Bw-46
  • Bw-47
  • Bw-48
  • Bw-50
  • Bw-52
  • Bw-53
  • Bw-54
  • Bw-55
  • Bw-56
  • Bw-57
  • Bw-58
  • Bw-60
  • HLA class I histocompatibility antigen, B alpha chain
  • HLA class I histocompatibility antigen, B-12 alpha chain
  • HLA class I histocompatibility antigen, B-21 alpha chain
  • HLA class I histocompatibility antigen, B-5 alpha chain
  • HLA class I histocompatibility antigen, B-7 alpha chain
  • HLAB
  • HLA-B
  • HLA-B27
  • HLA-B73
  • leukocyte antigen class I-B
  • lymphocyte antigen
  • major histocompatibility complex, class I, B
  • MGC111087
  • MHC class I antigen B*13
  • MHC class I antigen B*14
  • MHC class I antigen B*15
  • MHC class I antigen B*18
  • MHC class I antigen B*27
  • MHC class I antigen B*35
  • MHC class I antigen B*37
  • MHC class I antigen B*38
  • MHC class I antigen B*39
  • MHC class I antigen B*40
  • MHC class I antigen B*41
  • MHC class I antigen B*42
  • MHC class I antigen B*44
  • MHC class I antigen B*45
  • MHC class I antigen B*46
  • MHC class I antigen B*47
  • MHC class I antigen B*48
  • MHC class I antigen B*49
  • MHC class I antigen B*50
  • MHC class I antigen B*51
  • MHC class I antigen B*52
  • MHC class I antigen B*53
  • MHC class I antigen B*54
  • MHC class I antigen B*55
  • MHC class I antigen B*56
  • MHC class I antigen B*57
  • MHC class I antigen B*58
  • MHC class I antigen B*59
  • MHC class I antigen B*67
  • MHC class I antigen B*7
  • MHC class I antigen B*73
  • MHC class I antigen B*78
  • MHC class I antigen B*8
  • MHC class I antigen B*81
  • MHC class I antigen B*82
  • MHC class I antigen GN00104
  • MHC class I antigen HLA-B heavy chain
  • MHC class I antigen SHCHA
  • MHC Class I HLA heavy chain
  • MHC HLA-B cell surface glycoprotein
  • SPDA1

Background

HLA-B belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exon 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-B alleles have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-64775
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, Func, IHC, IHC-Fr, IHC-P (-), IP
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP2-45316
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB1225
Species: Hu
Applications: Block, CyTOF-reported, Flow
NBP3-07168
Species: Pm, Ca, Pm, Hu, Pm, Sq
Applications: Flow, ICC/IF
NBP3-46107
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NB500-302
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-59069
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-34234
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P
NBP3-35275
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF1936
Species: Hu
Applications: IP, WB
NBP1-89985
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western
AF347
Species: Hu
Applications: IHC, Neut, WB

Publications for HLA B Antibody (NBP3-35277) (0)

There are no publications for HLA B Antibody (NBP3-35277).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA B Antibody (NBP3-35277) (0)

There are no reviews for HLA B Antibody (NBP3-35277). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HLA B Antibody (NBP3-35277) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HLA B Products

Research Areas for HLA B Antibody (NBP3-35277)

Find related products by research area.

Blogs on HLA B

There are no specific blogs for HLA B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLA B Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-B