HIF-3 alpha Antibody - BSA Free

Images

 
Immunohistochemistry-Paraffin: HIF-3 alpha Antibody [NBP1-89977] - Staining of human prostate shows moderate to strong cytoplasmic and nuclear positivity in smooth muscle cells.
Staining of human skin shows moderate to strong cytoplasmic and nuclear positivity in squamous epithelial cells.
Staining of human placenta shows moderate to strong nuclear and cytoplasmic positivity in trophoblastic cells.
Staining of human Fallopian tube shows moderate to strong nuclear and cytoplasmic positivity in glandular cells.
ChIP-Exo-Seq composite graph for Anti-HIF3A (NBP1-89977) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, ChIP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

HIF-3 alpha Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SPDLRRLLGPILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HIF3A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HIF-3 alpha Protein (NBP1-89977PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for HIF-3 alpha Antibody - BSA Free

  • Basic-helix-loop-helix-PAS protein MOP7
  • BHLHe17
  • bHLHe17HIF-3A2
  • Class E basic helix-loop-helix protein 17
  • HIF-3 alpha
  • HIF3A
  • HIF-3A4
  • HIF-3-alpha
  • HIF3-alpha
  • hypoxia inducible factor 3, alpha subunit
  • hypoxia-inducible factor 3-alpha
  • hypoxia-inducible factor-3 alpha 4
  • Inhibitory PAS domain protein
  • IPAS
  • IPASHIF3-alpha-1
  • Member of PAS protein 7
  • MOP7
  • MOP7PAS domain-containing protein 7
  • PASD7
  • PASD7HIF-3A

Background

Hypoxia-inducible factor (HIF) is one of the most important factors in the cellular response to hypoxia, by transcriptionally activating genes encoding proteins that mediate adaptive responses to reduced oxygen availability. HIF is a heterodimer consisting of one of three subunits, HIF1 alpha, HIF2 alpha, or HIF3 alpha. HIF target genes play critical roles in metabolism, angiogenesis, cell proliferation and cell survival. HIF3 alpha protein is one of several alpha/beta-subunit heterodimeric transcription factors that regulate many adaptive responses to low oxygen tension (hypoxia). The alpha 3 subunit lacks the transactivation domain found in factors containing either the alpha 1 or alpha 2 subunits. HIF3 alpha may be a marker for tumor growth and angiogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
NB100-124
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: ChIP, CHIP-SEQ, GS, IB, ICC/IF, IHC,  IHC-P, IP, WB
NB100-122
Species: Fi, Ha, Hu, Mu, Pm, Rb, Rt, Re, Sh
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, KO, PAGE, Simple Western, WB
DVE00
Species: Hu
Applications: ELISA
NBP3-03807
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NBP1-68864
Species: Mu
Applications: PEP-ELISA, WB
NBP2-45411
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP2-61706
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-89977
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P
NBP2-21037
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-56146
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP2-31361
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC,  IHC-P
NBP1-89977
Species: Hu
Applications: IHC, ChIP

Publications for HIF-3 alpha Antibody (NBP1-89977) (0)

There are no publications for HIF-3 alpha Antibody (NBP1-89977).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIF-3 alpha Antibody (NBP1-89977) (0)

There are no reviews for HIF-3 alpha Antibody (NBP1-89977). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HIF-3 alpha Antibody (NBP1-89977) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HIF-3 alpha Products

Research Areas for HIF-3 alpha Antibody (NBP1-89977)

Find related products by research area.

Blogs on HIF-3 alpha.

HIF-2 alpha: HIF1A's Homologue with Similar and Divergent Functions
HIF-2 alpha is a member of the heterodimeric hypoxia-inducible factors/HIFs family (HIF-1, HIF-2, and HIF-3) which contains a common beta subunit but differ in their alpha subunits. Also called as EPAS1 or Mop2, HIF-2 alpha regulates cellular adapt...  Read full blog post.

HIF-3 alpha: a versatile target with hypoxia dependent and independent functions
By: Subhash GangarHIF-3 alpha (hypoxia-inducible factor 3-alpha/ HIF3A) represents an isoform of HIF-alpha subunits which heterodimerize with stable beta subunit (HIF-beta) for the regulation of HIF target genes through binding to hypoxia respon...  Read full blog post.

HIF Prolyl Hydroxylase 2: an important Oxygen Sensor Protein
Prolyl hydroxylase domain (PHD) proteins, including PHD1, PHD2, and PHD3, mediate oxygen-dependent degradation of hypoxia-inducible factor (HIF) alpha subunits. Suppression of PHD enzymes leads to stabilization of HIFs and offers a potential treatment...  Read full blog post.

HIF Antibodies: Beyond HIF-1 alpha
The hypoxia inducible factors are a family of heterodimeric transcription factors which are activated in response to lowered oxygen levels, or hypoxia. Although it may seem that HIF-1 alpha receives all the attention, other HIF antibodies, such as the...  Read full blog post.

A Role for HIF-1 alpha Antibody in Renal Research
The Hypoxia Inducible Factors (HIFs) are a family of mammalian transcription factors which are expressed in response to low cellular oxygen concentrations (hypoxia). Three human hypoxia inducible factors have been identified, HIF-1, HIF-2 and HIF-3, e...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HIF-3 alpha Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol HIF3A
Entrez
Uniprot