Hemopexin Antibody (1M6O3)

Western Blot: Hemopexin Antibody (1M6O3) [NBP3-16762] - Western blot analysis of extracts of Mouse lung, using Hemopexin (HPX) Rabbit mAb (NBP3-16762) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 2min.

Western Blot: Hemopexin Antibody (1M6O3) [NBP3-16762] - Western blot analysis of extracts of Human serum, using Hemopexin (HPX) Rabbit mAb (NBP3-16762) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunohistochemistry-Paraffin: Hemopexin Antibody (1M6O3) [NBP3-16762] - Immunohistochemistry of paraffin-embedded rat liver using Hemopexin (HPX) Rabbit mAb (NBP3-16762) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunocytochemistry/ Immunofluorescence: Hemopexin Antibody (1M6O3) [NBP3-16762] - Confocal imaging of paraffin-embedded Rat liver using Hemopexin Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunocytochemistry/ Immunofluorescence: Hemopexin Antibody (1M6O3) [NBP3-16762] - Confocal imaging of paraffin-embedded Human liver using Hemopexin Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunocytochemistry/ Immunofluorescence: Hemopexin Antibody (1M6O3) [Hemopexin] - Confocal imaging of paraffin-embedded Rat liver using Hemopexin Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunocytochemistry/ Immunofluorescence: Hemopexin Antibody (1M6O3) [Hemopexin] - Confocal imaging of paraffin-embedded Human liver using Hemopexin Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 1M6O3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Hemopexin Antibody (1M6O3) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 363-462 of human Hemopexin (P02790). AFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: HPX
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 52 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Hemopexin Antibody (1M6O3)

• Beta-1B-glycoprotein
• FLJ56652
• Hemopexin
• HPX
• HX

Background

The Hemopexin gene encodes a plasma glycoprotein that binds heme with high affinity. The encoded protein is an acute phaseprotein that transports heme from the plasma to the liver and may be involved in protecting cells from oxidativestress. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HPX