HEM1 Antibody - BSA Free

Western Blot: HEM1 Antibody [NBP2-13643] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunohistochemistry-Paraffin: HEM1 Antibody [NBP2-13643] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: HEM1 Antibody [NBP2-13643] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.

Immunohistochemistry-Paraffin: HEM1 Antibody [NBP2-13643] - Staining of human liver shows low positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: HEM1 Antibody [NBP2-13643] - Staining of human small intestine shows strong cytoplasmic positivity in lymphoid cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HEM1 Antibody - BSA Free Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit HEM1 Antibody - BSA Free (NBP2-13643) is a polyclonal antibody validated for use in IHC and WB. Anti-HEM1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: VLIRMYNIKKTCSDPKSKPPFLLEKSMEPSLKYINKKFPNIDVRNSTQHLGPVHREKAEIIRFLTNYYQSFVD
• Predicted Species: Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NCKAP1L
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HEM1 Protein (NBP2-13643PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HEM1 Antibody - BSA Free

• Hematopoietic protein 1HEM1Membrane-associated protein HEM-1
• NCK-associated protein 1-like

Background

HEM1 is encoded by this gene is a member of the HEM family of tissue-specific transmembrane proteins which are highly conserved from invertebrates through mammals. This gene is only expressed in hematopoietic cells, while hematopoietic protein 2 is preferentially expressed in brain, heart, liver and testis. The function of the HEM1 product has not been established but it is thought to play an essential role in oogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HEM1 Antibody (NBP2-13643)(2)

Publications using NBP2-13643

• Wang X, Shao L, Richardson KK et al. Hematopoietic Cytoplasmic Adaptor Protein Hem1 Promotes Osteoclast Fusion and Bone Resorption in Mice The Journal of biological chemistry 2022-12-24 [PMID: 36574841] (KO, WB, Mouse)
  
  Details:
  Dilution used 1:1000
• Pipathsouk A, Brunetti RM, Town JP et al. The WAVE complex associates with sites of saddle membrane curvature The Journal of cell biology 2021-08-02 [PMID: 34096975] (WB, Human)

Bioinformatics

• Gene Symbol: NCKAP1L