HEM1 Antibody

Images

 
Western Blot: HEM1 Antibody [NBP2-13643] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: HEM1 Antibody [NBP2-13643] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: HEM1 Antibody [NBP2-13643] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: HEM1 Antibody [NBP2-13643] - Staining of human liver shows low positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: HEM1 Antibody [NBP2-13643] - Staining of human small intestine shows strong cytoplasmic positivity in lymphoid cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HEM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VLIRMYNIKKTCSDPKSKPPFLLEKSMEPSLKYINKKFPNIDVRNSTQHL GPVHREKAEIIRFLTNYYQSFVD
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCKAP1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HEM1 Protein (NBP2-13643PEP)
Publications
Read Publications using
NBP2-13643 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HEM1 Antibody

  • Hematopoietic protein 1HEM1Membrane-associated protein HEM-1
  • NCK-associated protein 1-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5514
Species: Hu, Mu
Applications: WB
NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-32005
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NBP2-37912
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-81162
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB110-74569
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-31470
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87329
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-47123
Species: Hu
Applications: IHC, IHC-P, WB
202-IL
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-92637
Species: Hu, Rt
Applications: ICC/IF, WB
NBP3-03109
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-116
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
NB100-74398
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86872
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for HEM1 Antibody (NBP2-13643)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publications 1 - 2 of 2.
Publications using NBP2-13643 Applications Species
Pipathsouk A, Brunetti RM, Town JP et al. The WAVE complex associates with sites of saddle membrane curvature The Journal of cell biology Aug 2 2021 [PMID: 34096975] (WB, Human) WB Human
Wang X, Shao L, Warren A Et al. Hem1 promotes osteoclast fusion and bone resorption in mice Research Square Aug 13 2021 (WB) WB

Reviews for HEM1 Antibody (NBP2-13643) (0)

There are no reviews for HEM1 Antibody (NBP2-13643). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HEM1 Antibody (NBP2-13643) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HEM1 Products

Array NBP2-13643

Bioinformatics Tool for HEM1 Antibody (NBP2-13643)

Discover related pathways, diseases and genes to HEM1 Antibody (NBP2-13643). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HEM1 Antibody (NBP2-13643)

Discover more about diseases related to HEM1 Antibody (NBP2-13643).
 

Pathways for HEM1 Antibody (NBP2-13643)

View related products by pathway.

Blogs on HEM1

There are no specific blogs for HEM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HEM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NCKAP1L