WASF2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Analysis in human esophagus and skeletal muscle tissues. Corresponding WASF2 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: WASF2 Antibody [NBP2-37912] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antiibody staining is shown in green.
Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Staining of human esophagus shows moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Staining of human placenta shows strong cytoplasmic positivity in endothelial cells.
Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells
Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Staining of human skeletal muscle shows low positivity in myocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

WASF2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHPPPAP
Predicted Species
Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WASF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
WASF2 Protein (NBP2-37912PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WASF2 Antibody

  • IMD2
  • Protein WAVE-2
  • SCAR2suppressor of cyclic-AMP receptor (WASP-family)
  • Verprolin homology domain-containing protein 2
  • WAS protein family, member 2
  • WASP family Verprolin-homologous protein 2
  • WAVE2dJ393P12.2
  • wiskWASP family protein member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-13180
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
H00010097-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
AF1444
Species: Mu
Applications: IHC, WB
NBP1-30955
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-00810
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-59845
Species: Hu
Applications: IHC, IHC-P, IP (-), WB
NBP1-82512
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
AF5515
Species: Hu, Mu
Applications: WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP1-87914
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-03514
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF5414
Species: Hu
Applications: Simple Western, WB
NBP2-19491
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
NBP2-75395
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-94118
Species: Hu, Mu, Rt
Applications: WB
H00051531-B01P
Species: Hu, Rt
Applications: ICC/IF, WB
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB

Publications for WASF2 Antibody (NBP2-37912) (0)

There are no publications for WASF2 Antibody (NBP2-37912).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WASF2 Antibody (NBP2-37912) (0)

There are no reviews for WASF2 Antibody (NBP2-37912). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for WASF2 Antibody (NBP2-37912) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WASF2 Products

Array NBP2-37912

Bioinformatics Tool for WASF2 Antibody (NBP2-37912)

Discover related pathways, diseases and genes to WASF2 Antibody (NBP2-37912). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WASF2 Antibody (NBP2-37912)

Discover more about diseases related to WASF2 Antibody (NBP2-37912).
 

Pathways for WASF2 Antibody (NBP2-37912)

View related products by pathway.

PTMs for WASF2 Antibody (NBP2-37912)

Learn more about PTMs related to WASF2 Antibody (NBP2-37912).
 

Research Areas for WASF2 Antibody (NBP2-37912)

Find related products by research area.

Blogs on WASF2

There are no specific blogs for WASF2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WASF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WASF2
Uniprot