HEBP1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: HEBP1 Antibody [NBP2-57944] - Staining of human cell line SK-MEL-30 shows localization to vesicles.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HEBP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HEBP1 Antibody - BSA Free (NBP2-57944) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HEBP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HEBP1 Recombinant Protein Antigen (NBP2-57944PEP)

Reactivity Notes

Mouse 87%, Rat 87%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HEBP1 Antibody - BSA Free

• HBPHEBP
• heme binding protein 1
• heme-binding protein 1
• p22HBP

Background

HEBP1, also known as Heme-binding protein 1, is a 189 amino acid that is approx. 21 kDa, contains a natural chemoattractant peptide of 21 amino acids at the N-terminus, which is a natural ligand for formyl peptide receptor-like receptor 2 (FPRL2) and stimulates calcium mobilization and chemotaxis in monocytes and dendritic cells; capable of binding free porphyrinogens and thus facilitates removal of these potentially toxic compound; heme or porphyrins; metalloporphyrins, free porphyrins and N-methylprotoporphyrin. Disease research has been performed on the relationship of this protein to ankylosis, root resorption, dental enamel hypoplasia, rickets, and breast cancer. The protein has been linked to the GPCR downstream signaling, peptide ligand-binding receptors, formyl peptide receptors bind formyl peptides and many other ligands, signal transduction, and signaling by GPCR pathways where interacts with over 100 proteins including GOT1, KCNMA1, FPR1, FPR2, and FPR3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HEBP1