HDLBP Antibody - BSA Free

Staining of human cell line hTERT-RPE1 shows localization to endoplasmic reticulum.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HDLBP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HDLBP Antibody - BSA Free (NBP3-24896) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein HDLBP using the following amino acid sequence: LHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYK
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HDLBP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HDLBP Antibody - BSA Free

• HBPFLJ16432
• HDL-binding protein
• high density lipoprotein binding protein
• High density lipoprotein-binding protein
• PRO2900
• VGLvigilin

Background

HDL-binding protein 1 (HDLBP) is a novel protein that may be involved in the regulation of the delivery of fats to cells for energy and storage. Digested fats travel to the small intestine, where they are packaged into chylomicrons (particles filled with triglycerides). Chylomicrons then travel through the bloodstream and deliver triglycerides to tissues that are hungry for fuel or to adipose tissue for energy storage. Triglycerides are broken down or hydrolyzed by the enzyme lipoprotein lipase (LpL). The triglyceride breakdown products are then taken up and used by cells. HDLBP is the molecule in capillaries that facilitates the capture of chylomicrons and facilitates the interaction with LpL. It has been shown that fats in the bloodstream are not readily metabolized in the absence of HDLBP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HDLBP