Apolipoprotein A-II/ApoA2 Antibody (5F7U1)


Western Blot: Apolipoprotein A-II/ApoA2 Antibody (5F7U1) [NBP3-16168] - Western blot analysis of extracts of Human plasma cells, using Apolipoprotein A-II/ApoA2 antibody (NBP3-16168) at 1:1000 dilution. Secondary ...read more
Immunohistochemistry: Apolipoprotein A-II/ApoA2 Antibody (5F7U1) [NBP3-16168] - Analysis of mouse liver using Apolipoprotein A-II/ApoA2 Rabbit mAb (NBP3-16168) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear ...read more
Immunohistochemistry: Apolipoprotein A-II/ApoA2 Antibody (5F7U1) [NBP3-16168] - Analysis of rat liver using Apolipoprotein A-II/ApoA2 Rabbit mAb (NBP3-16168) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear ...read more

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC

Order Details

Apolipoprotein A-II/ApoA2 Antibody (5F7U1) Summary

Additional Information
Recombinant Monoclonal Antibody
Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human Apolipoprotein A-II/ApoA2 (NP_001634.1). MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS, 0.05% BSA, 50% glycerol, pH7.3
0.02% Sodium Azide
Affinity purified

Alternate Names for Apolipoprotein A-II/ApoA2 Antibody (5F7U1)

  • Alp-2
  • APOA2
  • apoAII
  • Apo-AII
  • ApoA-II
  • Apolipoprotein A2
  • Apolipoprotein AII
  • Apolipoprotein A-II
  • Hdl-1


At least 9 distinct polymorphic forms of apolipoproteins are known. The apolipoproteins act as stabilizers of the intact lipoprotein particles. Quantitative measurements of HDL, LDL and VLDL particles in human serum are often used to estimate an individuals' relative risk of coronary heart disease. In addition, quantitative immunological measurements of certain apolipoproteins (especially A-1 and B) have been suggested to be more accurate estimators of coronary heart disease than measurements of lipoprotein particles (especially HDL and LDL). This apo-lipoprotein antibody is derived from human plasma by density gradient ultracentrifugation and HPLC.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Apolipoprotein A-II/ApoA2 Antibody (NBP3-16168) (0)

There are no publications for Apolipoprotein A-II/ApoA2 Antibody (NBP3-16168).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein A-II/ApoA2 Antibody (NBP3-16168) (0)

There are no reviews for Apolipoprotein A-II/ApoA2 Antibody (NBP3-16168). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Apolipoprotein A-II/ApoA2 Antibody (NBP3-16168) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Apolipoprotein A-II/ApoA2 Products

Research Areas for Apolipoprotein A-II/ApoA2 Antibody (NBP3-16168)

Find related products by research area.

Blogs on Apolipoprotein A-II/ApoA2

There are no specific blogs for Apolipoprotein A-II/ApoA2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Apolipoprotein A-II/ApoA2 Antibody (5F7U1) and receive a gift card or discount.


Gene Symbol APOA2