Apolipoprotein A-II/ApoA2 Antibody (5F7U1)

Western Blot: Apolipoprotein A-II/ApoA2 Antibody (5F7U1) [NBP3-16168] - Western blot analysis of extracts of Human plasma cells, using Apolipoprotein A-II/ApoA2 antibody (NBP3-16168) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunocytochemistry/ Immunofluorescence: Apolipoprotein A-II/ApoA2 Antibody (5F7U1) [NBP3-16168] - Immunofluorescence analysis of mouse liver using Apolipoprotein A-II/ApoA2 Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry: Apolipoprotein A-II/ApoA2 Antibody (5F7U1) [NBP3-16168] - Analysis of rat liver using Apolipoprotein A-II/ApoA2 Rabbit mAb (NBP3-16168) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 5F7U1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Apolipoprotein A-II/ApoA2 Antibody (5F7U1) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human Apolipoprotein A-II/ApoA2 (NP_001634.1). MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: APOA2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 17 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Apolipoprotein A-II/ApoA2 Antibody (5F7U1)

• Alp-2
• APOA2
• apoAII
• Apo-AII
• ApoA-II
• Apolipoprotein A2
• Apolipoprotein AII
• Apolipoprotein A-II
• Hdl-1

Background

At least 9 distinct polymorphic forms of apolipoproteins are known. The apolipoproteins act as stabilizers of the intact lipoprotein particles. Quantitative measurements of HDL, LDL and VLDL particles in human serum are often used to estimate an individuals' relative risk of coronary heart disease. In addition, quantitative immunological measurements of certain apolipoproteins (especially A-1 and B) have been suggested to be more accurate estimators of coronary heart disease than measurements of lipoprotein particles (especially HDL and LDL). This apo-lipoprotein antibody is derived from human plasma by density gradient ultracentrifugation and HPLC.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: APOA2