HDLBP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HDLBP Antibody [NBP1-83287] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: HDLBP Antibody [NBP1-83287] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HDLBP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DMNQFGEGEQAKICLEIMQRTGAHLELSLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HDLBP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HDLBP Protein (NBP1-83287PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HDLBP Antibody

  • HBPFLJ16432
  • HDL-binding protein
  • high density lipoprotein binding protein
  • High density lipoprotein-binding protein
  • PRO2900
  • VGLvigilin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF2200
Species: Hu
Applications: WB, IP
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57716
Species: Hu
Applications: WB
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
H00120776-R02
Species: Hu

Publications for HDLBP Antibody (NBP1-83287) (0)

There are no publications for HDLBP Antibody (NBP1-83287).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HDLBP Antibody (NBP1-83287) (0)

There are no reviews for HDLBP Antibody (NBP1-83287). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HDLBP Antibody (NBP1-83287). (Showing 1 - 1 of 1 FAQ).

  1. For NBP1-45962, do you have any paper or data of evidence for size of mature form is 19-36kDa? And why there was difference for size between NBP1-45962 (80-110kDa) and NBP1-83287 (140kDa)?
    • Our HDLBP antibody #NBP1-45962 was generated as a collaborative project, so that I do not have direct access to its QC data. I have already passed your request about the research paper/reference to our collaborator who is the originator of this antibody. Moreover, I am looking into the details of why this product was discontinued, and I will let you know as soon as I have any further information. The canonical isoform of HDLBP protein is 1,268 amino acids long and it is processed further whereby the initiator methionine is removed. Its expected molecular weight is 141kD, however, the observed molecular weight may vary because of the posttranslational modifications involved (Acetylation and Phosphoprotein in case of HDLBP). Moreover, it is not very uncommon to see 10-20% change in the expected VS observed molecular weight of proteins in WB assay, especially for the high molecular weight proteins!

Secondary Antibodies

 

Isotype Controls

Additional HDLBP Products

Bioinformatics Tool for HDLBP Antibody (NBP1-83287)

Discover related pathways, diseases and genes to HDLBP Antibody (NBP1-83287). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HDLBP Antibody (NBP1-83287)

Discover more about diseases related to HDLBP Antibody (NBP1-83287).
 

Pathways for HDLBP Antibody (NBP1-83287)

View related products by pathway.

PTMs for HDLBP Antibody (NBP1-83287)

Learn more about PTMs related to HDLBP Antibody (NBP1-83287).
 

Research Areas for HDLBP Antibody (NBP1-83287)

Find related products by research area.

Blogs on HDLBP

There are no specific blogs for HDLBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HDLBP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HDLBP