HBG1/2 Antibody - BSA Free

Western Blot: HBG1/2 Antibody [NBP1-98291] - Western blot analysis of human fetal liver using NBP1-98291. Antibody Dilution: 1.0 ug/ml

Western Blot: HBG1/2 Antibody [NBP1-98291] - Hemoglobin gamma-2 chain Antibody [NBP1-98291] - Human Fetal Kidney Lysate 1.0ug/ml, Gel Concentration: 10-20%

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

HBG1/2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen for this antibody is HBG2 - middle region. Peptide sequence MGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFK. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HBG1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 147 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for HBG1/2 Antibody - BSA Free

• abnormal hemoglobin
• A-gamma globin
• gamma A hemoglobin
• gamma globin
• Gamma-1-globin
• gamma-2-globin
• gamma-globin chain
• G-gamma globin Paulinia
• Hb F Agamma
• hb F Ggamma
• HBGA
• HBGR
• HBG-T1
• HBG-T2
• Hemoglobin gamma-1 chain
• hemoglobin gamma-2 chain
• Hemoglobin gamma-A chain
• hemoglobin gamma-G chain
• hemoglobin subunit gamma-1
• hemoglobin subunit gamma-2
• hemoglobin, gamma A
• hemoglobin, gamma G
• hemoglobin, gamma, regulator of
• HSGGL1
• methemoglobin
• PRO2979
• TNCY

Background

The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HBG1
• Uniprot:
  • NP_000175(Human)