ABH1 Antibody

Images

 
Western Blot: ABH1 Antibody [H00008846-B01P] - Analysis of ALKBH1 expression in transfected 293T cell line by ALKBH1 polyclonal antibody. Lane 1: ALKBH transfected lysate(42.79 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: ABH1 Antibody [H00008846-B01P] - Analysis of purified antibody to ALKBH on HeLa cell. (antibody concentration 10 ug/ml)
Immunohistochemistry-Paraffin: ABH1 Antibody [H00008846-B01P] - Analysis of purified antibody to ALKBH1 on formalin-fixed paraffin-embedded human skeletal muscle. (antibody concentration 3 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC-P
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ABH1 Antibody Summary

Immunogen
ALKBH1 (AAH25787.1, 1 a.a. - 389 a.a.) full-length human protein. MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSGFSRLLNHAVPRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPHS
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ALKBH1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
This antibody is useful for WB, Functional, IF and IHC-P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ABH1 Antibody

  • ABH1
  • ABHalkB, alkylation repair homolog (E. coli)
  • alkB
  • alkB, alkylation repair homolog 1 (E. coli)
  • ALKBH
  • alkylated DNA repair protein alkB homolog 1
  • alkylation repair, alkB homolog
  • Alpha-ketoglutarate-dependent dioxygenase ABH1
  • DNA lyase ABH1
  • EC 1.14.11.-
  • EC 4.2.99.18
  • hABH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84274
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76276
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-57016
Species: Hu
Applications: WB
H00004340-B01P
Species: Hu, Rt
Applications: WB
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-233
Species: Hu
Applications: WB, PLA
NB100-81657
Species: Hu, Mu
Applications: WB, IHC-P, IP

Publications for ABH1 Antibody (H00008846-B01P) (0)

There are no publications for ABH1 Antibody (H00008846-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABH1 Antibody (H00008846-B01P) (0)

There are no reviews for ABH1 Antibody (H00008846-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ABH1 Antibody (H00008846-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABH1 Products

Bioinformatics Tool for ABH1 Antibody (H00008846-B01P)

Discover related pathways, diseases and genes to ABH1 Antibody (H00008846-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABH1 Antibody (H00008846-B01P)

Discover more about diseases related to ABH1 Antibody (H00008846-B01P).
 

Pathways for ABH1 Antibody (H00008846-B01P)

View related products by pathway.

PTMs for ABH1 Antibody (H00008846-B01P)

Learn more about PTMs related to ABH1 Antibody (H00008846-B01P).
 

Research Areas for ABH1 Antibody (H00008846-B01P)

Find related products by research area.

Blogs on ABH1

There are no specific blogs for ABH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALKBH1
Uniprot