Reactivity | Hu, MuSpecies Glossary |
Applications | WB, ICC/IF, IHC, IHC-P |
Clonality | Polyclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | ALKBH1 (AAH25787.1, 1 a.a. - 389 a.a.) full-length human protein. MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSGFSRLLNHAVPRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPHS |
Isotype | IgG |
Clonality | Polyclonal |
Host | Mouse |
Gene | ALKBH1 |
Purity | Protein G purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | This antibody is useful for WB, Functional, IF and IHC-P. |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.4) |
Preservative | No Preservative |
Purity | Protein G purified |
Publication using H00008846-B01P | Applications | Species |
---|---|---|
Trixl L, Amort T, Wille A et al. RNA cytosine methyltransferase Nsun3 regulates embryonic stem cell differentiation by promoting mitochondrial activity. Cell Mol Life Sci Nov 4 2017 [PMID: 29103146] |
Secondary Antibodies |
Isotype Controls |
Diseases for ABH1 Antibody (H00008846-B01P)Discover more about diseases related to ABH1 Antibody (H00008846-B01P).
| Pathways for ABH1 Antibody (H00008846-B01P)View related products by pathway.
|
PTMs for ABH1 Antibody (H00008846-B01P)Learn more about PTMs related to ABH1 Antibody (H00008846-B01P).
| Research Areas for ABH1 Antibody (H00008846-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | ALKBH1 |
Uniprot |
|