G protein alpha inhibitor 1 Antibody - BSA Free

Images

 
Western Blot: G protein alpha inhibitor 1 Antibody [NBP1-52926] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:12500 Positive Control: Human brain
Western Blot: G protein alpha inhibitor 1 Antibody [NBP1-52926] - Sample Type: Nthy-ori cell lysate (50ug) Primary Dilution: 1:1000 Secondary Antibody: anti-rabbit HRP Secondary Dilution: 1:2000
Western Blot: G protein alpha inhibitor 1 Antibody [NBP1-52926] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
Western Blot: G protein alpha inhibitor 1 Antibody [NBP1-52926] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

G protein alpha inhibitor 1 Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to GNAI1(guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1) The peptide sequence was selected from the middle region of GNAI1 (NP_002060). Peptide sequence YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH The peptide sequence for this immunogen was taken from within the described region.
Specificity
This product is specific to Subunit or Isoform: alpha-1.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNAI1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-52926.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for G protein alpha inhibitor 1 Antibody - BSA Free

  • Adenylate cyclase-inhibiting G alpha protein
  • Gi
  • Gi1 protein alpha subunit
  • guanine nucleotide binding protein (G protein), alpha inhibiting activitypolypeptide 1
  • guanine nucleotide-binding protein G(i) subunit alpha-1

Background

Guanine nucleotide-binding proteins (G proteins) form a large family of signal-transducing molecules. They are found as heterotrimers made up of alpha, beta, and gamma subunits. Members of the G protein family have been characterized most extensively on the basis of the alpha subunit, which binds guanine nucleotide, is capable of hydrolyzing GTP, and interacts with specific receptor and effector molecules. The G protein family includes Gs and Gi, the stimulatory and inhibitory GTP-binding regulators of adenylate cyclase; Go, a protein abundant in brain (GNAO1); and transducin-1 (GNAT1) and transducin-2 (GNAT2), proteins involved in phototransduction in retinal rods and cones, respectively.Guanine nucleotide-binding proteins (G proteins) form a large family of signal-transducing molecules. They are found as heterotrimers made up of alpha, beta, and gamma subunits. Members of the G protein family have been characterized most extensively on the basis of the alpha subunit, which binds guanine nucleotide, is capable of hydrolyzing GTP, and interacts with specific receptor and effector molecules. The G protein family includes Gs (MIM 139320) and Gi, the stimulatory and inhibitory GTP-binding regulators of adenylate cyclase; Go, a protein abundant in brain (GNAO1; MIM 139311); and transducin-1 (GNAT1; MIM 139330) and transducin-2 (GNAT2; MIM 139340), proteins involved in phototransduction in retinal rods and cones, respectively (Sullivan et al., 1986 [PubMed 3092218]; Bray et al., 1987 [PubMed 3110783]). Suki et al. (1987) [PubMed 2440724] concluded that the human genome contains at least 3 nonallelic genes for alpha-i-type subunits of G protein; see, e.g, GNAI2 (MIM 139360), GNAI3 (MIM 139370), and GNAIH (MIM 139180).[supplied by OMIM]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
NBP2-62664
Species: Hu
Applications: IHC,  IHC-P
NBP1-91928
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-82243
Species: Hu
Applications: IHC,  IHC-P
NBP1-88223
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-81829
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-86665
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-32550
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP3-47534
Species: Hu, Mu
Applications: ELISA, IHC, WB
H00006936-B01P
Species: Hu
Applications: ICC/IF, WB
M6000B
Species: Mu
Applications: ELISA
NBP3-12223
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for G protein alpha inhibitor 1 Antibody (NBP1-52926)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-52926 Applications Species
Hurst,JH. Cell. Signal. 20 (2), 381-389. 2008-01-01 [PMID: 18083345]

Reviews for G protein alpha inhibitor 1 Antibody (NBP1-52926) (0)

There are no reviews for G protein alpha inhibitor 1 Antibody (NBP1-52926). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for G protein alpha inhibitor 1 Antibody (NBP1-52926) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional G protein alpha inhibitor 1 Products

Research Areas for G protein alpha inhibitor 1 Antibody (NBP1-52926)

Find related products by research area.

Blogs on G protein alpha inhibitor 1

There are no specific blogs for G protein alpha inhibitor 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our G protein alpha inhibitor 1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol GNAI1
Uniprot