HAPLN1 Antibody

Images

 
Western Blot: HAPLN1 Antibody [NBP1-59150] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HAPLN1 Antibody Summary

Immunogen
Synthetic peptides corresponding to HAPLN1(hyaluronan and proteoglycan link protein 1) The peptide sequence was selected from the N terminal of HAPLN1. Peptide sequence ENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HAPLN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HAPLN1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HAPLN1 Antibody

  • Cartilage link protein
  • Cartilage-link protein
  • Cartilage-linking protein 1
  • CRTL1
  • CRTL1cartilage linking protein 1
  • HAPLN1
  • hyaluronan and proteoglycan link protein 1
  • Proteoglycan link protein

Background

HAPLN1 stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF5800
Species: Mu, Rt
Applications: WB, IHC
AF4009
Species: Hu, Rt
Applications: WB, IHC, IP, ICC
NBP2-20454
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
AF4085
Species: Hu
Applications: WB, IHC, IP
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NB600-844
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP1-87784
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3865
Species: Hu
Applications: WB, IHC
NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
1705-HH/CF
Species: Hu, Mu
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for HAPLN1 Antibody (NBP1-59150) (0)

There are no publications for HAPLN1 Antibody (NBP1-59150).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HAPLN1 Antibody (NBP1-59150) (0)

There are no reviews for HAPLN1 Antibody (NBP1-59150). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HAPLN1 Antibody (NBP1-59150) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HAPLN1 Products

Bioinformatics Tool for HAPLN1 Antibody (NBP1-59150)

Discover related pathways, diseases and genes to HAPLN1 Antibody (NBP1-59150). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HAPLN1 Antibody (NBP1-59150)

Discover more about diseases related to HAPLN1 Antibody (NBP1-59150).
 

Pathways for HAPLN1 Antibody (NBP1-59150)

View related products by pathway.

PTMs for HAPLN1 Antibody (NBP1-59150)

Learn more about PTMs related to HAPLN1 Antibody (NBP1-59150).

Blogs on HAPLN1

There are no specific blogs for HAPLN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HAPLN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HAPLN1
Entrez
Uniprot