HADH Antibody

Images

 
Western Blot: HADH Antibody [NBP1-83300] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: HADH Antibody [NBP1-83300] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Western Blot: HADH Antibody [NBP1-83300] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HADH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HADH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HADH Protein (NBP1-83300PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HADH Antibody

  • EC 1.1.1
  • EC 1.1.1.35
  • HADH1
  • HADHSChydroxyacyl-Coenzyme A dehydrogenase
  • HCDH
  • hydroxyacyl-CoA dehydrogenase
  • L-3-hydroxyacyl-Coenzyme A dehydrogenase, short chain
  • Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase
  • MGC8392
  • mitochondrial
  • MSCHAD
  • SCHADHHF4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-02118
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NBP2-16679
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-00206
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-45978
Species: Hu
Applications: WB, Flow, IHC
NBP1-54755
Species: Hu
Applications: WB
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34980
Species: Hu

Publications for HADH Antibody (NBP1-83300) (0)

There are no publications for HADH Antibody (NBP1-83300).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HADH Antibody (NBP1-83300) (0)

There are no reviews for HADH Antibody (NBP1-83300). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HADH Antibody (NBP1-83300) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HADH Products

Bioinformatics Tool for HADH Antibody (NBP1-83300)

Discover related pathways, diseases and genes to HADH Antibody (NBP1-83300). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HADH Antibody (NBP1-83300)

Discover more about diseases related to HADH Antibody (NBP1-83300).
 

Pathways for HADH Antibody (NBP1-83300)

View related products by pathway.

PTMs for HADH Antibody (NBP1-83300)

Learn more about PTMs related to HADH Antibody (NBP1-83300).
 

Research Areas for HADH Antibody (NBP1-83300)

Find related products by research area.

Blogs on HADH

There are no specific blogs for HADH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HADH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HADH