GYPB Antibody - Azide and BSA Free

Western Blot: GYPB Antibody [NBP3-03929] - Western blot analysis of extracts of Human serum, using GYPB Rabbit pAb (NBP3-03929) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GYPB Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit GYPB Antibody - Azide and BSA Free (NBP3-03929) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-91 of human GYPB (NP_002091.3). MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCVMAGIIGTILLISYTIRRLIKA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GYPB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500-1:2000
• Theoretical MW: 10 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for GYPB Antibody - Azide and BSA Free

• CD235b antigen
• glycophorin B (includes Ss blood group)
• glycophorin B (MNS blood group)
• glycophorin B (Ss blood group)
• glycophorin HeP2
• glycophorin MiVI
• glycophorin-B
• GPB.NY
• GPBHGpMiVI
• GYPHe.NY
• MNS
• PAS-3
• Sialoglycoprotein delta
• Ss blood group
• SS-active sialoglycoprotein
• SSCD235b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: GYPB