GTPBP4 Antibody

Images

 
Western Blot: GTPBP4 Antibody [NBP1-85454] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: GTPBP4 Antibody [NBP1-85454] - Staining of human cell line U-2 OS shows positivity in nucleoli, nuclear membrane and cytoplasm.
Immunohistochemistry-Paraffin: GTPBP4 Antibody [NBP1-85454] - Staining of human cerebellum shows strong nucleolar positivity in purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GTPBP4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PLFINKPLIVVANKCDVKRIAELSEDDQKIFTDLQSEGFPVIETSTLTEEGVIKVKTEACDRLLAHRVETKMKGNKVNEVLNRLHLAIPT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GTPBP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GTPBP4 Protein (NBP1-85454PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GTPBP4 Antibody

  • Chronic renal failure gene protein
  • CRFGGTP-binding protein NGB
  • FLJ10686
  • FLJ10690
  • G protein-binding protein CRFG
  • GTP binding protein 4
  • NGB
  • NOG1FLJ39774
  • nucleolar GTP-binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
H00114757-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-02398
Species: Hu, Mk
Applications: ELISA, IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP2-37471
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2369
Species: Hu
Applications: ICC/IF, IHC
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NBP2-55474
Species: Hu
Applications: ICC/IF
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl

Publications for GTPBP4 Antibody (NBP1-85454) (0)

There are no publications for GTPBP4 Antibody (NBP1-85454).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTPBP4 Antibody (NBP1-85454) (0)

There are no reviews for GTPBP4 Antibody (NBP1-85454). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GTPBP4 Antibody (NBP1-85454) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GTPBP4 Products

Bioinformatics Tool for GTPBP4 Antibody (NBP1-85454)

Discover related pathways, diseases and genes to GTPBP4 Antibody (NBP1-85454). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTPBP4 Antibody (NBP1-85454)

Discover more about diseases related to GTPBP4 Antibody (NBP1-85454).
 

Pathways for GTPBP4 Antibody (NBP1-85454)

View related products by pathway.

PTMs for GTPBP4 Antibody (NBP1-85454)

Learn more about PTMs related to GTPBP4 Antibody (NBP1-85454).
 

Research Areas for GTPBP4 Antibody (NBP1-85454)

Find related products by research area.

Blogs on GTPBP4

There are no specific blogs for GTPBP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GTPBP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GTPBP4