SUCLG1 Antibody

Western Blot: SUCLG1 Antibody [NBP1-89489] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue

Immunocytochemistry/Immunofluorescence: SUCLG1 Antibody [NBP1-89489] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining in human kidney and pancreas tissues using anti-SUCLG1 antibody. Corresponding SUCLG1 RNA-seq data are presented for the same tissues.

Western Blot: SUCLG1 Antibody [NBP1-89489] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Western Blot: SUCLG1 Antibody [NBP1-89489] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Western Blot: SUCLG1 Antibody [NBP1-89489] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue

Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human kidney shows high expression.

Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SUCLG1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LPQNGIRHCSYTASRQHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQTHLGLPVFNTVKEAKEQTGA
• Specificity: Specificity of human, mouse, rat SUCLG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SUCLG1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Positive Control:

  SUCLG1 Lysate (NBP2-66047)

• Control Peptide:

  SUCLG1 Protein (NBP1-89489PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SUCLG1 Antibody

• EC 6.2.1
• EC 6.2.1.4
• FLJ21114
• FLJ43513
• GALPHA
• MTDPS9
• SCS-alpha
• succinate-CoA ligase, alpha subunit
• succinate-CoA ligase, GDP-forming, alpha subunit
• succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial
• Succinyl-CoA synthetase subunit alpha
• SUCLA1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SUCLG1