Home » SUCLG1 » SUCLG1 Antibodies » SUCLG1 Antibody

SUCLG1 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: SUCLG1 Antibody [NBP1-89489] - Analysis using Anti-SUCLG1 antibody NBP1-89489 (A) shows similar pattern to independent antibody NBP2-38318 (B).
Independent Antibodies: Western Blot: SUCLG1 Antibody [NBP1-89489] - Analysis using Anti-SUCLG1 antibody NBP1-89489 (A) shows similar pattern to independent antibody NBP2-38318 (B).
Immunocytochemistry/ Immunofluorescence: SUCLG1 Antibody [NBP1-89489] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human stomach shows strong granular cytoplasmic positivity in glandular cells.
Western Blot: SUCLG1 Antibody [NBP1-89489] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Western Blot: SUCLG1 Antibody [NBP1-89489] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Western Blot: SUCLG1 Antibody [NBP1-89489] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue
Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human pancreas shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining in human kidney and pancreas tissues using anti-SUCLG1 antibody. Corresponding SUCLG1 RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human cerebral cortex, colon, kidney and pancreas using Anti-SUCLG1 antibody NBP1-89489 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human colon.
Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human cerebellum shows strong granular cytoplasmic positivity in cells in granular layer.
Independent Antibodies: Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human cerebellum, fallopian tube, kidney and stomach using Anti-SUCLG1 antibody NBP1-89489 (A) shows similar ...read more
Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human Fallopian tube shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

      

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

SUCLG1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LPQNGIRHCSYTASRQHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQTHLGLPVFNTVKEAKEQTGA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SUCLG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SUCLG1 Protein (NBP1-89489PEP)
Publications
Read Publication using
NBP1-89489 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SUCLG1 Antibody

  • EC 6.2.1
  • EC 6.2.1.4
  • FLJ21114
  • FLJ43513
  • GALPHA
  • MTDPS9
  • SCS-alpha
  • succinate-CoA ligase, alpha subunit
  • succinate-CoA ligase, GDP-forming, alpha subunit
  • succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial
  • Succinyl-CoA synthetase subunit alpha
  • SUCLA1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SUCLG2 Antibody
NBP1-32521
Immunocytochemistry/Immunofluorescence: SUCLG2 Antibody [NBP1-32521] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: SUCLG2 protein stained by SUCLG2 antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Western Blot: SUCLG2 Antibody [NBP1-32521] - Wild-type (WT) and SUCLG2 knockout (KO) 293T cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with SUCLG2 antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunohistochemistry-Paraffin: SUCLG2 Antibody [NBP1-32521] - Paraffin-embedded hepatoma. SUCLG2 antibody dilution: 1:500
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
GPRC6A Antibody -
BSA Free
NLS2576
Immunohistochemistry-Paraffin: GPRC6A Antibody [NLS2576] - Human Ovary, Carcinoma formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: GPRC6A Antibody [NLS2576] - Breast, carcinoma
Immunohistochemistry-Paraffin: GPRC6A Antibody [NLS2576] - Brain, Hypothalamus, neurons of the tuberal nucleus
(3 Publications)
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
LPAR3/LPA3/EDG-7
Antibody - BSA Free
NLS1017
Immunohistochemistry-Paraffin: LPAR2/LPA2/EDG-4 Antibody [NLS1017] - Anti-LPAR3 / LPA3 / EDG7 antibody IHC of human Colon, Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: LPAR2/LPA2/EDG-4 Antibody [NLS1017] - Analysis of anti-EDG7 antibody with human brain, amygdala.
Immunohistochemistry-Paraffin: LPAR2/LPA2/EDG-4 Antibody [NLS1017] - Anti-LPAR3 / LPA3 / EDG7 antibody IHC of human heart, myocardial infarct. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Frizzled-4
Antibody (145901)
MAB194
Frizzled-4 Antibody (145901)
(4 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
GPR151 Antibody -
BSA Free
NLS418
Immunohistochemistry-Paraffin: GPR151 Antibody [NLS418] - Analysis of anti-GPR151 antibody with brain, thalamus at 2 ug/ ml.
Immunohistochemistry-Paraffin: GPR151 Antibody [NLS418] - Analysis of anti-GPR151 antibody with human brain, glioblastoma.
Immunohistochemistry-Paraffin: GPR151 Antibody [NLS418] - Anti-GPR151 antibody IHC of human Lung, Non-Small Cell Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Hu
Applications: IHC, IHC-P
Lgr6 Antibody
(918719) [Unconjugate
MAB8458
HEK293 human embryonic kidney cell line transfected with human Lgr6 and eGFP was stained with either (A) Mouse Anti-Human Lgr6 Monoclonal Antibody (Catalog # MAB8458) or (B) Mouse IgG1 Isotype Control (Catalog # MAB002) followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B).
Lgr6 was detected in immersion fixed HEK293 human embryonic kidney cell line transfected with human Lgr6 and eGFP (green) using Mouse Anti-Human Lgr6 Monoclonal Antibody (Catalog # MAB8458) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
(1 Publication)
Species: Hu
Applications: CyTOF-ready, Flow, ICC
MRGX1 Antibody -
BSA Free
NLS2756
Immunohistochemistry-Paraffin: MRGX1 Antibody [NLS2756] - Analysis of anti-MRGPRX1 / MRGX1 antibody with human ganglion cells and Schwann cells.
Immunohistochemistry-Paraffin: MRGX1 Antibody [NLS2756] - Anti-MRGX1 / MRGPRX1 antibody IHC of human Ovary, Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: MRGX1 Antibody [NLS2756] - Anti-MRGX1 / MRGPRX1 antibody IHC of human Skin, Melanoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
(SZ25-01)
NBP2-67360
Flow Cytometry: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of Hela cells with ERK2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
Rhodopsin Antibody
(B630)
NBP2-25160
Immunohistochemistry: Rhodopsin Antibody (B630) [NBP2-25160] - Rhodopsin expression and the prevalence of rod photoreceptors in the canine retina. (A) Fluorescence micrographs showing rhodopsin expression (red) in the ABCA4+/+ (left), ABCA4+/- (middle), and ABCA4-/- (right) rod outer segments. Scale bar = 10 um. Image collected and cropped by CiteAb from the following publication (doi.org/10.1371/journal.pgen.1007873) licensed under a CC-BY licence.
Western Blot: Rhodopsin Antibody (B630) [NBP2-25160] - Western blot analyses of ABCA4 (above), GAPDH (middle), and RHO (below) protein levels in retinal tissue of dogs with the three different genotypes. Image collected and cropped by CiteAb from the following publication. 50 ug of protein samples were resolved by SDS-PAGE, transferred to nitrocellulose membrane, and immunoblotted with the following primary antibodies: ABCA4 (NBP1-30032, 1:1000) and Rhodopsin (NBP2-25160, 1:5000), followed by Anti-Mouse IgG horseradish peroxidase-conjugated secondary antibody (R&D Systems, HAF007, 1:5000. Image collected and cropped by CiteAb from the following publication (doi.org/10.1371/journal.pgen.1007873) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (B630) [NBP2-25160] - High magnification confocal image of pig retinal section stained with NBP2-25160 (Green). Rhodopsin is most abundant in the rod outer segments (ROS) of retina, clearly localized in rod membranes. The rod inner segments (RIS) and rod nuclei in the outer nuclear layer (ONL) are also seen in this image. Nuclear DNA was stained with DAPI (blue).
(4 Publications)
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
RGS4 Antibody
NBP2-94071
Immunocytochemistry/Immunofluorescence: RGS4 Antibody [NBP2-94071] - Analysis of L929 cells using RGS4 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: RGS4 Antibody [NBP2-94071] - Analysis of U-2 OS cells using RGS4 at dilution of 1:100. Blue: DAPI for nuclear staining.
Western Blot: RGS4 Antibody [NBP2-94071] - Analysis of extracts of various cell lines, using RGS4 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 1s.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Endorepellin/Perlecan/ ...
AF2364
Endorepellin/Perlecan was detected in immersion fixed paraffin-embedded sections of human skin using 5 µg/mL Goat Anti-Human Endorepellin/Perlecan Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2364) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(5 Reviews)
(4 Publications)
Species: Hu
Applications: IHC, WB
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot: PRRT2 Antibody [NBP2-82026] - Analysis of PRRT2 in mouse brain tissue lysate with PRRT2 antibody at 1 ug/ml.
Immunohistochemistry: PRRT2 Antibody [NBP2-82026] - Immunohistochemistry of PRRT2 in rat brain tissue with PRRT2 antibody at 2.5 ug/ml.
Immunocytochemistry/Immunofluorescence: PRRT2 Antibody [NBP2-82026] - Immunofluorescence of PRRT2 in rat brain tissue with PRRT2 antibody at 20 ug/ml.
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
SUCLG1 Antibody
NBP1-89489
SUCLG1 Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SUCLG1 Antibody (NBP1-89489)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SUCLG1 Antibody (NBP1-89489) (0)

There are no reviews for SUCLG1 Antibody (NBP1-89489). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SUCLG1 Antibody (NBP1-89489) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SUCLG1 Products

Bioinformatics Tool for SUCLG1 Antibody (NBP1-89489)

Discover related pathways, diseases and genes to SUCLG1 Antibody (NBP1-89489). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUCLG1 Antibody (NBP1-89489)

Discover more about diseases related to SUCLG1 Antibody (NBP1-89489).
 

Pathways for SUCLG1 Antibody (NBP1-89489)

View related products by pathway.

Research Areas for SUCLG1 Antibody (NBP1-89489)

Find related products by research area.

Blogs on SUCLG1

There are no specific blogs for SUCLG1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUCLG1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SUCLG1