SUCLG1 Antibody

Images

 
Western Blot: SUCLG1 Antibody [NBP1-89489] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue
Immunocytochemistry/ Immunofluorescence: SUCLG1 Antibody [NBP1-89489] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & mitochondria.
Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human colon shows strong cytoplasmic positivity(granular pattern) in glandular cells.
Western Blot: SUCLG1 Antibody [NBP1-89489] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Western Blot: SUCLG1 Antibody [NBP1-89489] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Western Blot: SUCLG1 Antibody [NBP1-89489] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SUCLG1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LPQNGIRHCSYTASRQHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQTHLGLPVFNTVKEAKEQTGA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SUCLG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SUCLG1 Protein (NBP1-89489PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SUCLG1 Antibody

  • EC 6.2.1
  • EC 6.2.1.4
  • FLJ21114
  • FLJ43513
  • GALPHA
  • MTDPS9
  • SCS-alpha
  • succinate-CoA ligase, alpha subunit
  • succinate-CoA ligase, GDP-forming, alpha subunit
  • succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial
  • Succinyl-CoA synthetase subunit alpha
  • SUCLA1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32521
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
H00441931-R02
Species: Hu
H00442206-R02
Species: Hu
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF2364
Species: Hu
Applications: WB, IHC
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SUCLG1 Antibody (NBP1-89489) (0)

There are no publications for SUCLG1 Antibody (NBP1-89489).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUCLG1 Antibody (NBP1-89489) (0)

There are no reviews for SUCLG1 Antibody (NBP1-89489). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SUCLG1 Antibody (NBP1-89489) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SUCLG1 Products

Bioinformatics Tool for SUCLG1 Antibody (NBP1-89489)

Discover related pathways, diseases and genes to SUCLG1 Antibody (NBP1-89489). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUCLG1 Antibody (NBP1-89489)

Discover more about diseases related to SUCLG1 Antibody (NBP1-89489).
 

Pathways for SUCLG1 Antibody (NBP1-89489)

View related products by pathway.

Blogs on SUCLG1

There are no specific blogs for SUCLG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUCLG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SUCLG1